KEGG   Rattus norvegicus (rat): 100912534
Entry
100912534         CDS       T01003                                 

Definition
(RefSeq) DNA-directed RNA polymerases I, II, and III subunit RPABC3-like
  KO
K03016  DNA-directed RNA polymerases I, II, and III subunit RPABC3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03020  RNA polymerase
rno04623  Cytosolic DNA-sensing pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    100912534
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    100912534
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    100912534
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    100912534
   03400 DNA repair and recombination proteins [BR:rno03400]
    100912534
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol I, II, III common subunits
     100912534
  RNA polymerase III system
   RNA polymerase III
     100912534
  RNA polymerase I system
   RNA polymerase I
     100912534
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      100912534
SSDB
Motif
Pfam: RNA_pol_Rpb8 RNA_pol_RpbG
Other DBs
NCBI-GeneID: 100912534
NCBI-ProteinID: XP_003751131
RGD: 6486461
Ensembl: ENSRNOG00000001748
UniProt: G3V678
Position
11q23
AA seq 150 aa
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF
NT seq 453 nt   +upstreamnt  +downstreamnt
atggcgggcatcctgttcgaggatattttcgatgtgaaagacattgacccagaaggcaag
aaatttgaccgagtatcccgtctgcattgtgagagtgaatctttcaagatggacctcatc
ttagatgtaaacattcagatttaccctgtagacttaggtgacaagttccggttggttata
gctagtactttgtatgaagatggtaccttggatgatggtgaatacaaccccacagacgac
aggccttccagggctgaccagtttgagtatgtaatgtatgggaaagtgtacaggatcgaa
ggggacgagacctcaacggaagcagccacacgtctctctgcgtatgtgtcctatggcggc
ctcctcatgaggcttcagggggacgccaacaacctgcatggatttgaggtggactcccga
gtctacctgctgatgaagaagctggcgttctga

DBGET integrated database retrieval system