KEGG   Rattus norvegicus (rat): 100912585
Entry
100912585         CDS       T01003                                 

Definition
(RefSeq) mitogen-activated protein kinase 7-like
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04540  Gap junction
rno04657  IL-17 signaling pathway
rno04722  Neurotrophin signaling pathway
rno04912  GnRH signaling pathway
rno04921  Oxytocin signaling pathway
rno05206  MicroRNAs in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100912585
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100912585
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100912585
  09152 Endocrine system
   04912 GnRH signaling pathway
    100912585
   04921 Oxytocin signaling pathway
    100912585
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100912585
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100912585
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100912585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    100912585
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100912585
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100912585
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH
Other DBs
NCBI-GeneID: 100912585
NCBI-ProteinID: XP_006246617
RGD: 6486357
Ensembl: ENSRNOG00000047907
UniProt: E9PTH2
Position
10q23
AA seq 812 aa
MAEPLKEEDGEDGSGEPPGRVKAEPVHSAASVVAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFRSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPVCPDVEMP
SPWAPSGDCAMESPPPALPPCSGPAPDTVDLTLQPAPPASELAPPKREGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGTLGGPSTDPLAGLVLSDNDRSLLERWTRMARPPVPAPAPAPAPTPKPTPTPTQS
SAQPTSPPNGPVSQSTAPLQPAGSIPGPASQPVCPPPGPVPQPAGPVPAPLQTAPSTSLL
ASQSLVPPSGLPGSGAPEVLPYFPSGPPPPDPGLTPQPSTSESPDVNLVTQQLSKSQVED
PLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDSQADSASLSASLLADWLEG
HGMNPADIESLQREIQMDSPMLLSDLPDLQEP
NT seq 2439 nt   +upstreamnt  +downstreamnt
atggccgaaccgttgaaggaggaggacggcgaagatggctctggggaaccccctgggcgg
gtgaaggcagaacccgtccactccgctgcatctgtcgtggccaagaacctggccctgctc
aaagcccgctccttcgacgtgacctttgacgtgggggacgagtacgagatcatcgagacc
ataggcaatggggcctacggggtggtgtcctcggcgcgccgccgcctcacgggtcagcag
gtggccatcaagaagatacctaatgcttttgatgtggtgaccaatgccaaacggaccctc
agggaactgaagatcctcaaacacttcaaacacgacaatatcatcgccatcaaggacatc
ctgaggcccactgtgccctatggagaattcagatctgtctacgtggtactggacctcatg
gaaagtgacctacaccagatcattcactcttcacagccgctcacactagaacatgtgaga
tacttcctataccagctgcttcggggcctcaaatacatgcactctgctcaggtcatccac
cgcgatcttaaaccctctaaccttttggtcaatgagaactgtgagctcaagattggtgac
tttggaatggcccgtggcctgtgtacatcccctgccgagcaccagtacttcatgactgag
tatgtggccactcgctggtaccgtgctcctgaactcatgctttcgctgcatgagtacaca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctggctcggcgacag
ctcttcccaggcaaaaactatgtgcatcagttacagctgatcatgatggtgttgggaact
ccatcaccagctgtgattcaggctgtgggggctgaaagggtgcgagcctatatccagagc
ctgccaccaaggcagcctgtaccttgggagacagtatacccgggtgctgaccgccaggcc
ctctcactgctgggacgcatgttgcgatttgaacccagtgcccgaatctcagctgctgct
gcccttcgccaccccttcctggctaagtaccacgaccctgacgatgagcctgattgcgcc
ccaccttttgactttgcttttgaccgtgaagcccttaccagggagcgcattaaggaggcc
attgtggctgagattgaggacttccatgcacgacgggagggcatccgccaacaaattcgc
ttccagccctctttgcagcctgtggctagtgagcctgtgtgtccagatgtcgagatgccc
agcccctgggctccaagtggagactgtgccatggagtcacctcctccagcactaccacca
tgctctggccctgcccctgacactgttgatctgactctgcagcctgccccgcccgccagt
gagcttgctccgccaaaaagagagggtgccatctccgacaataccaaagcagccctcaaa
gctgctctgctcaagtccctgaggagccggcttcgagatgggcccagtgcacccttggag
gcccctgaacctcgaaagcctgtgacagctcaggaacgtcagcgagagcgagaagagaag
cgcaggaggcgacaagagagagccaaggagagggagaagcgacgacaagagcgggagcgc
aaggagaggggggctggcaccttggggggcccctctactgaccctttggctggattggtg
ctcagtgacaatgaccgaagcctgctagagcggtggactcgcatggctaggcctcctgtc
cctgcaccagcaccagcaccagcaccaacaccaaaaccaacaccaacaccaacacagtcc
tctgctcaacccactagtcctcccaatggccctgtatctcagtctactgctcctctacag
cctgcaggctctattcctggtcctgcctcccagcctgtttgcccaccccctgggcctgtt
ccccagcctgctggccctgtccctgcccctctccagactgccccttccactagccttttg
gcctcccagtcacttgtgccacctagtgggttgcctggttctggtgccccagaagttctg
ccttacttcccatctggcccaccacctccagatcctgggctcacccctcagccttctaca
tcagagtcacctgatgtcaacctggtgacccagcaactgtccaagtctcaggtggaggac
cccctgcctcccgtgttctcaggcactccaaagggcagtggggctggctacggtgttggc
tttgacctggaggaattcttaaaccaatcttttgacatgggtgtggctgatgggccacag
gatagccaggcagactcagcctcactctcagcctccctccttgctgactggcttgagggc
cacggcatgaaccccgctgacattgagtctctgcagcgtgagatccagatggactcccca
atgttgctgtctgacctgcctgacctccaagaaccctga

DBGET integrated database retrieval system