KEGG   Rattus norvegicus (rat): 100912604
Entry
100912604         CDS       T01003                                 

Definition
(RefSeq) spermidine synthase-like
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00270  Cysteine and methionine metabolism
rno00330  Arginine and proline metabolism
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Module
rno_M00034  Methionine salvage pathway
rno_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    100912604
   00330 Arginine and proline metabolism
    100912604
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100912604
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     100912604
SSDB
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_31 Methyltransf_25
Other DBs
NCBI-GeneID: 100912604
NCBI-ProteinID: XP_003749506
RGD: 6485978
Ensembl: ENSRNOG00000046379
UniProt: Q99MI5
Position
3p11
AA seq 302 aa
MEPGPDGPAAPGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYG
NVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESV
VQCEIDEDVIEVSKKFLPGMAVGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGP
AESLFKESYYQLMKTALKEDGILCCQGECQWLHLDLIKEMRHFCKSLFPVVSYAYCTIPT
YPSGQIGFMLCSKNPSTNFREPVQQLTQAQVEQMQLKYYNSDMHRAAFVLPEFTRKALND
IS
NT seq 909 nt   +upstreamnt  +downstreamnt
atggagcctggccccgacggcccagccgcgcccggccccgccgccatccgtgagggttgg
ttccgagagacctgcagcctgtggcctggccaggccctgtcgctgcaagtggagcagctg
ctgcaccaccggcgctcgcggtaccaagacatcctcgtcttccgcagtaaaacctacggc
aacgtgctggttctggatggcgtcatccagtgtaccgagagggacgagttctcctaccag
gagatgatagccaacctgccgctctgcagccaccccaacccgcggaaggtgctgatcatc
gggggtggagatgggggcgtcctacgggaagtggtgaagcacccctctgtggagtctgtg
gtccagtgcgagatcgatgaggatgtcattgaggtctctaagaagttcctgcctggcatg
gccgttggctactccagctcaaagctgactctccacgtgggcgatggctttgagttcatg
aagcagaaccaagatgcctttgatgtcatcatcaccgactcctcagaccccatgggccct
gctgagagcctcttcaaggagtcctattaccagctcatgaagacagccctcaaagaagat
ggcatcctctgttgccagggcgagtgccagtggctgcacctggacctcatcaaggagatg
aggcatttctgcaagtctctcttccctgtggtgagctatgcctactgtaccattcccacc
tatcccagtggccagatcggcttcatgctgtgtagcaaaaacccgagcaccaacttccgg
gagcccgtgcagcagctgacacaggcccaggtagagcagatgcagctgaagtactataac
tcagacatgcaccgcgcggccttcgtgctgccagagttcacccgaaaggccctgaatgac
ataagctga

DBGET integrated database retrieval system