KEGG   Rattus norvegicus (rat): 102546590
Entry
102546590         CDS       T01003                                 

Definition
(RefSeq) patr class I histocompatibility antigen, A-126 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102546590
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102546590
   04145 Phagosome
    102546590
  09143 Cell growth and death
   04218 Cellular senescence
    102546590
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102546590
   04612 Antigen processing and presentation
    102546590
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102546590
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102546590
   05170 Human immunodeficiency virus 1 infection
    102546590
   05168 Herpes simplex virus 1 infection
    102546590
   05163 Human cytomegalovirus infection
    102546590
   05167 Kaposi sarcoma-associated herpesvirus infection
    102546590
   05169 Epstein-Barr virus infection
    102546590
   05165 Human papillomavirus infection
    102546590
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102546590
   05330 Allograft rejection
    102546590
   05332 Graft-versus-host disease
    102546590
  09166 Cardiovascular disease
   05416 Viral myocarditis
    102546590
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102546590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    102546590
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    102546590
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   102546590
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  102546590
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 102546590
NCBI-ProteinID: XP_038955298
RGD: 7624899
Position
20
AA seq 311 aa
MAANSSHWLQTFNTVILEPGMTEPRLIQVSYVDSIQFQGFDSQAPNASMQPRAAWIEQEP
PEYWEKETTQVVSLTLSKGRILRYIANENRHSRNDYRTLQEVFGCNLANDGTFLRGNYRL
TYYDYDYVTLNEDMISWRAEGEIAKRWLSIWETEGVGESWMTYLRGTCSERLLRFLELGK
KTLLRSDAPKTHLTHQVRPDGNVTLRCWALGFYPADITLTWQRDGKNHTQDMELPDTRPA
GDGTFQKWAAVMVPSGEEQRYTCHVHHEGLPEPLTLKWEPSTTIPIVAILIGLIVVTLVI
GTVVILRVWKK
NT seq 936 nt   +upstreamnt  +downstreamnt
atggctgccaacagttcacactggctgcagactttcaacactgtgattttggagcctgga
atgacagagccccggttgatccaggtcagctatgtagactccatccagtttcagggattc
gacagccaagctcccaatgcgagtatgcaacctcgggctgcttggatagagcaggagcca
cctgaatattgggagaaggagacaacacaagtcgtgagcctgacactgtcaaaaggacgg
attcttaggtatatagcaaatgaaaatcgacacagcaggaatgattatcgcaccctgcag
gaagtttttggctgcaacttggcaaatgatgggaccttcctccgaggtaattaccggctc
acctattatgactacgattacgtcactctgaatgaggacatgatctcttggagagcagaa
ggcgagatagctaaacgttggttaagcatatgggaaaccgaaggagtgggagaaagctgg
atgacttacctgagaggaacgtgctcagaaaggcttcttagattcctggaacttggaaag
aagactttgctgcgctctgatgcccccaaaacacatctgacccaccaagtaagacctgat
ggcaacgtcaccctgaggtgctgggccctgggcttctacccagctgacatcaccctgacc
tggcagagggatggcaaaaaccacacccaggacatggagctgccagacaccaggcctgca
ggggatggaaccttccagaaatgggcggcagtgatggttccttctggagaggagcagaga
tacacatgtcatgtgcaccacgaagggctccctgagcctctcactctgaagtgggaacct
tcaacaaccatccccatcgtggcaattctcatcggcctgattgttgtaacattggtgata
ggaactgtggtgattcttcgggtatggaagaaataa

KEGG   Rattus norvegicus (rat): 24747
Entry
24747             CDS       T01003                                 

Gene name
RT1-M3-1
Definition
(RefSeq) RT1 class Ib, locus M3-1 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    24747 (RT1-M3-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    24747 (RT1-M3-1)
   04145 Phagosome
    24747 (RT1-M3-1)
  09143 Cell growth and death
   04218 Cellular senescence
    24747 (RT1-M3-1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    24747 (RT1-M3-1)
   04612 Antigen processing and presentation
    24747 (RT1-M3-1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    24747 (RT1-M3-1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24747 (RT1-M3-1)
   05170 Human immunodeficiency virus 1 infection
    24747 (RT1-M3-1)
   05168 Herpes simplex virus 1 infection
    24747 (RT1-M3-1)
   05163 Human cytomegalovirus infection
    24747 (RT1-M3-1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24747 (RT1-M3-1)
   05169 Epstein-Barr virus infection
    24747 (RT1-M3-1)
   05165 Human papillomavirus infection
    24747 (RT1-M3-1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    24747 (RT1-M3-1)
   05330 Allograft rejection
    24747 (RT1-M3-1)
   05332 Graft-versus-host disease
    24747 (RT1-M3-1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    24747 (RT1-M3-1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    24747 (RT1-M3-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24747 (RT1-M3-1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    24747 (RT1-M3-1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24747 (RT1-M3-1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  24747 (RT1-M3-1)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 24747
NCBI-ProteinID: NP_075210
RGD: 3494
Ensembl: ENSRNOG00000000763
Vega: OTTRNOG00000001434
UniProt: G3V627
Position
20
AA seq 339 aa
MATSNKFSLLLMVVVALAVSRTGAGTHSLRYFHTALSRPGRGEPQYISVGYVDDKLFQRC
DSVEEIPRMEARAPWMEKEGPEYWEELKLKVKSIAQRARARLRTLIRYYNQSEGSSHILQ
WMVACEVGPDMRLLGAHYQAAYDGSDYITLNEDLSSWTAADMVAQITKSELESEGRAEYF
RAYVDGECLELLHRFLQNGKEILQRADPPKAHVTLHPRPEGDVTLRCWALGFYPADITLT
WQLNGEDLTQDMELVETKPSGDGTFQKWASVVVPSGEEQKYTCHVEHEGLPEPLVLKWGG
SSQSFVVIMVIIVIIVILALLGGVLTVVLVYRRRGAGML
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcgacctcaaacaagttctctctcctgctgatggtggtggtcgctctggctgttagc
cgaacaggtgctggcacacattcactgcgttatttccacactgccctgtcacggccgggc
cgtggggagcctcaatatatttctgtcggctatgtggatgacaagctgtttcagcgctgt
gatagcgttgaggagattccgaggatggaggcccgtgcaccttggatggagaaggaagga
ccagagtattgggaggagctgaaactcaaagtaaaaagcattgcacaaagagccagagca
agacttcggaccttgatccgctactacaaccagagtgaaggcagttctcacatcctgcag
tggatggttgcctgcgaggtggggccagacatgagacttcttggagcacactatcaggct
gcatatgacggctcggattacatcaccctgaatgaggacctgagctcctggactgcagca
gacatggtggctcagatcacgaagagcgagttagagtcagaaggtagagcagaatacttc
agagcctatgtggatggagagtgcctggagctgctccatagattcctgcagaatggaaaa
gagattcttcagagagcagatcccccaaaggcacatgtgacccttcacccaagacctgaa
ggtgatgtcaccctgaggtgttgggccctgggcttctaccctgctgacatcaccctaacc
tggcagttgaatggggaggacctgacccaggacatggagcttgtggagaccaagccttca
ggggatggaaccttccagaagtgggcatctgtggtggtgccttctggagaggagcagaaa
tacacatgccatgtggagcatgaggggctgcctgagcctcttgtcctgaaatggggagga
tcgtctcagtcctttgtcgtcatcatggtcatcatagtaatcattgttattctggctctc
ctgggaggtgtgctcactgttgttttggtgtacaggaggaggggtgcaggcatgctctga

KEGG   Rattus norvegicus (rat): 24750
Entry
24750             CDS       T01003                                 

Gene name
RT1-N3
Definition
(RefSeq) RT1 class Ib, locus N3
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    24750 (RT1-N3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    24750 (RT1-N3)
   04145 Phagosome
    24750 (RT1-N3)
  09143 Cell growth and death
   04218 Cellular senescence
    24750 (RT1-N3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    24750 (RT1-N3)
   04612 Antigen processing and presentation
    24750 (RT1-N3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    24750 (RT1-N3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24750 (RT1-N3)
   05170 Human immunodeficiency virus 1 infection
    24750 (RT1-N3)
   05168 Herpes simplex virus 1 infection
    24750 (RT1-N3)
   05163 Human cytomegalovirus infection
    24750 (RT1-N3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24750 (RT1-N3)
   05169 Epstein-Barr virus infection
    24750 (RT1-N3)
   05165 Human papillomavirus infection
    24750 (RT1-N3)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    24750 (RT1-N3)
   05330 Allograft rejection
    24750 (RT1-N3)
   05332 Graft-versus-host disease
    24750 (RT1-N3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    24750 (RT1-N3)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    24750 (RT1-N3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24750 (RT1-N3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    24750 (RT1-N3)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24750 (RT1-N3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  24750 (RT1-N3)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2 TMEM154
Other DBs
NCBI-GeneID: 24750
NCBI-ProteinID: NP_001008855
RGD: 1598370
Ensembl: ENSRNOG00000000795
Vega: OTTRNOG00000001566
UniProt: Q6MG01 A0A023GRW5
Position
20
AA seq 393 aa
MLWVPKAAARWLSALLQILLLNACFSWTWTLVGSHSLRYFSTVMSWPGLREPRIIVSGYI
DNMEFLRLDSDAETPRVKPLVPWLEQEGLEYLEQQIHRIRTQAQQSERNLMTLVRFYNKS
MDDFHTLQWQQGCDVGSDGRLLHWYDQLAFDGIDHPTLNKDLRFWTAWTSTVAQISQPEL
EARLKDNCSELLQKYPEKEKERLLRSDPPRAHVTRHPRPESDVTLRCWALGFYPADITLT
WQLNGEDLIQEMEFVETRPAGDGTFQKWASVVVPLGKEQKYTCLVEHEGLSEPLTLRWEP
AQDSTTTIILIILPTVSAIALCVAAVATCICLKKKAGERGRHDTQEADGDSPQDSSKIVV
DDQEMEDPFWNTENYRTHLGYRSGTLGFLSLSP
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgctctgggttcctaaggctgctgcgcgctggctcagtgcccttctccagatcctgctc
ctgaatgcctgcttctcctggacttggacccttgtgggctcacactccctgcggtatttc
tccactgtcatgtcctggcccggcctccgggagccaaggataatagtcagcggctacata
gataatatggagttcctgcgcttggacagcgacgccgaaactccaagggtgaagccccta
gtaccatggctggagcaggaggggctggaatacttggagcagcagattcatagaatcagg
actcaagcacaacagtctgaaaggaacctgatgacgctggttcgtttttacaataagagc
atggacgacttccacacactacagtggcagcaaggctgcgatgtggggtcagatgggcgc
ctgcttcactggtacgaccagctcgcctttgatggcatagatcaccccaccctgaacaaa
gacctgcgtttctggacagcgtggaccagcactgtagctcagatctctcagcccgagtta
gaagctcgcctgaaggacaactgctcagagctgctgcagaaatacccagaaaaggagaag
gagaggctgctgcgttcagacccgccaagggcacatgtgacccggcaccccagacctgaa
agtgatgtgaccctgaggtgctgggccctgggtttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggacctgatccaagaaatggagtttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtgcctctagggaaggagcagaag
tacacatgccttgtggagcatgaggggctgtcagagccgctcaccctgagatgggagcct
gcccaggactccaccactacaatcattctaattattctacccactgtctctgcaattgcc
ctctgcgttgctgctgtggcaacttgcatatgcctgaagaagaaggcaggtgaaagagga
aggcacgacacccaggaagcagatggagacagtccccaagactctagcaagattgttgtg
gatgatcaggagatggaggatcccttttggaatactgagaactacagaactcatctagga
taccgctctgggactttaggatttctaagcttgtcaccctaa

KEGG   Rattus norvegicus (rat): 24751
Entry
24751             CDS       T01003                                 

Gene name
RT1-O1
Definition
(RefSeq) RT1 class Ib, locus O1
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    24751 (RT1-O1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    24751 (RT1-O1)
   04145 Phagosome
    24751 (RT1-O1)
  09143 Cell growth and death
   04218 Cellular senescence
    24751 (RT1-O1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    24751 (RT1-O1)
   04612 Antigen processing and presentation
    24751 (RT1-O1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    24751 (RT1-O1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24751 (RT1-O1)
   05170 Human immunodeficiency virus 1 infection
    24751 (RT1-O1)
   05168 Herpes simplex virus 1 infection
    24751 (RT1-O1)
   05163 Human cytomegalovirus infection
    24751 (RT1-O1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24751 (RT1-O1)
   05169 Epstein-Barr virus infection
    24751 (RT1-O1)
   05165 Human papillomavirus infection
    24751 (RT1-O1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    24751 (RT1-O1)
   05330 Allograft rejection
    24751 (RT1-O1)
   05332 Graft-versus-host disease
    24751 (RT1-O1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    24751 (RT1-O1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    24751 (RT1-O1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24751 (RT1-O1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    24751 (RT1-O1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24751 (RT1-O1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  24751 (RT1-O1)
SSDB
Motif
Pfam: C1-set ig
Other DBs
NCBI-GeneID: 24751
NCBI-ProteinID: NP_001008856
RGD: 3501
UniProt: Q6MG00
Position
20
AA seq 181 aa
MAPCCCCSCCWWPPWPLPGLLPEKPPKTHVTHHPSPEGDVTLRCWALGFYTADITLTWKR
DGENLTQDMELVETRPAGDGTFQKWAAVVVPSGEEENYTCLVEHEGLPEPLTLRWGSSIH
QLQHGNHCCPGCPWSCGHHRSCGGCCEEEEEKHRWKRRGLCSSSKQQQCPQLGLLSGDLK
R
NT seq 546 nt   +upstreamnt  +downstreamnt
atggctccgtgctgctgctgctcctgctgctggtggcctccttggcctttaccaggactc
ctaccagagaaacccccaaagacacatgtgacccaccaccccagtcctgaaggtgatgtc
accctgaggtgctgggccctgggcttctacactgctgacatcactctgacctggaagagg
gatggggagaacctgacccaggacatggagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggcagctgtggtggtgccttctggagaggaggagaattacacatgc
cttgtggagcatgaggggctgcctgagcccctcaccctgagatggggctcctccatccac
caactccaacatgggaatcattgctgtcctggttgtccttggagctgtggccatcatagg
agctgtggtggctgttgtgaggaagaggaggagaaacacaggtggaaaaggaggggacta
tgctccagctcaaagcagcaacagtgtccacagctgggactcctctcaggagacttgaaa
aggtga

KEGG   Rattus norvegicus (rat): 24973
Entry
24973             CDS       T01003                                 

Gene name
RT1-A1
Definition
(RefSeq) RT1 class Ia, locus A1 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    24973 (RT1-A1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    24973 (RT1-A1)
   04145 Phagosome
    24973 (RT1-A1)
  09143 Cell growth and death
   04218 Cellular senescence
    24973 (RT1-A1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    24973 (RT1-A1)
   04612 Antigen processing and presentation
    24973 (RT1-A1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    24973 (RT1-A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24973 (RT1-A1)
   05170 Human immunodeficiency virus 1 infection
    24973 (RT1-A1)
   05168 Herpes simplex virus 1 infection
    24973 (RT1-A1)
   05163 Human cytomegalovirus infection
    24973 (RT1-A1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24973 (RT1-A1)
   05169 Epstein-Barr virus infection
    24973 (RT1-A1)
   05165 Human papillomavirus infection
    24973 (RT1-A1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    24973 (RT1-A1)
   05330 Allograft rejection
    24973 (RT1-A1)
   05332 Graft-versus-host disease
    24973 (RT1-A1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    24973 (RT1-A1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    24973 (RT1-A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24973 (RT1-A1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    24973 (RT1-A1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24973 (RT1-A1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  24973 (RT1-A1)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig Psg1 Ig_2 C2-set_2 Marek_A CcmD
Other DBs
NCBI-GeneID: 24973
NCBI-ProteinID: NP_001008827
RGD: 1595924
Ensembl: ENSRNOG00000038999
Vega: OTTRNOG00000001831
UniProt: Q6MGB9
Position
20
AA seq 369 aa
MGAMAPRTLLLILAAALAPTQTRAGSHSMRYFDIAVSRPGLGEPRFIIVGYVDDTEFVRF
DSDAEKPRYEPRAPWMEPEGPEYWEEQTRRAKEGEQTFRVNLRTALHYYNQSEDRSHTIQ
RLSGCDVGSDGRLLRGYEQYAYDGRDYIALNEDLKTWTAADFAARISRNKWDQAGVAERL
RAYLEGECVEWLRRYLELGKETLLRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLT
WQLNGEDLTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVEHEGLPEPLSQRWEP
PPSTDSNMETTVIYVVLGAVAIIAAVIIGAVVTVVRKRRRNTGGKGVYTPAPGTDSSQSS
DVSLPDCKA
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgggggcgatggcaccccgcacgctgctcctgatcctggcggccgccctggccccgacc
cagacccgcgcgggctctcactcgatgcggtatttcgacatcgccgtgtcccggcccggc
ctcggggagccccggttcattatcgtcggctacgtggacgacacggagttcgtgcgcttc
gacagcgacgcggagaaaccgagatacgagccgcgggcgccgtggatggagccggagggg
ccggagtattgggaggagcagacacggagagccaaggaaggcgagcagactttccgagtg
aacctgaggaccgcgctccactactacaaccagagcgaggaccgctctcacaccatccag
agattgtctggctgtgacgtggggtcggacgggaggctcctccgcgggtatgagcagtac
gcctacgatggccgcgattacatcgccctgaacgaagacctgaaaacgtggacggcggcg
gactttgcggcacggatctcccggaacaagtgggatcaggctggtgttgcagagagactc
agggcctacctggagggcgagtgtgtggagtggctccgcagatacctggagctcgggaag
gagacgctgctgcgctcagatcccccaaaggcacatgtgacccttcaccccagacctgaa
ggtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtacctcttgggaaggagcagaat
tacacatgccgtgtggagcatgaggggctgcctgagccactttcccagagatgggagcct
cctccatcaaccgattccaacatggaaaccactgtcatttatgttgtccttggagctgtg
gccatcattgcagctgtgatcattggagctgtggtgactgttgtgaggaagaggaggaga
aacacaggtgggaaaggagtctacacccctgctccaggcacggacagctcccagagctct
gatgtgtctctcccagattgtaaagcatga

KEGG   Rattus norvegicus (rat): 24974
Entry
24974             CDS       T01003                                 

Gene name
RT1-A2
Definition
(RefSeq) RT1 class Ia, locus A2 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    24974 (RT1-A2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    24974 (RT1-A2)
   04145 Phagosome
    24974 (RT1-A2)
  09143 Cell growth and death
   04218 Cellular senescence
    24974 (RT1-A2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    24974 (RT1-A2)
   04612 Antigen processing and presentation
    24974 (RT1-A2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    24974 (RT1-A2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24974 (RT1-A2)
   05170 Human immunodeficiency virus 1 infection
    24974 (RT1-A2)
   05168 Herpes simplex virus 1 infection
    24974 (RT1-A2)
   05163 Human cytomegalovirus infection
    24974 (RT1-A2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24974 (RT1-A2)
   05169 Epstein-Barr virus infection
    24974 (RT1-A2)
   05165 Human papillomavirus infection
    24974 (RT1-A2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    24974 (RT1-A2)
   05330 Allograft rejection
    24974 (RT1-A2)
   05332 Graft-versus-host disease
    24974 (RT1-A2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    24974 (RT1-A2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    24974 (RT1-A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24974 (RT1-A2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    24974 (RT1-A2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24974 (RT1-A2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  24974 (RT1-A2)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig MHC_I_3 Psg1 Ig_2 C2-set_2 Gram_pos_anchor
Other DBs
NCBI-GeneID: 24974
NCBI-ProteinID: NP_001008829
RGD: 1595923
Ensembl: ENSRNOG00000030712
Vega: OTTRNOG00000001830
UniProt: Q6MGB8
Position
20
AA seq 366 aa
MMEPCTLLLLLAVALTPTQTRAGSHSLRYFVTAVSRPGLGEPRYMEVGYVDDTQFVRYDS
DAENPRYEPRAPWMEREGPEYWERETQNAKRNEQVYRVDLRTALRYYNQSEGGSHTIQRM
YGCDMGSDGSLLRGYYQDAYDGRDYIALNEDLKTWTAADFAAQITRSKWDQAGVAERLRA
YLEGTCVEWLRRYLELGKETLLRSDPPEAHVTLHPRPEGDVTLRCWALGFYPADITLTWQ
LNGEDLTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVEHEGLPEPLSQRWEPSP
STNSNMETTVIYVVLGAIIGTLAIIGIVVAVVRKRRRNTGGKGDYTPAPGRDSSQSSDVS
LPDCKA
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgatggagccctgcactctgctcctgctgctggcggtcgccctgaccccgacccagacc
cgcgccggctctcactcgctgcggtatttcgtcaccgccgtgtcccggcccggcctcggg
gagccccggtacatggaagtgggctacgtggacgacacgcagttcgtgcgctacgacagc
gatgcagagaatccgagatacgagccgcgggcgccgtggatggagcgggaggggccggag
tattgggagagggagacccagaacgccaagagaaacgagcaggtttaccgagtggacctg
aggaccgcgctccgctactacaaccagagcgagggcggctctcacaccatccagaggatg
tatggctgtgacatggggtcggacgggagcctcctccgcgggtattatcaggacgcttac
gacggccgcgattacatcgccctgaacgaagacctgaaaacgtggacggcggcggacttt
gcggcacagatcacccggagcaagtgggatcaggctggtgttgcagagagactcagggcc
tacctggagggcacgtgcgtggagtggctccgcagatacctggaactcgggaaggagacg
ctgctgcgctcagatcccccagaggcacatgtgacccttcaccccagacctgaaggtgat
gtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcag
ttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcctgcaggggat
ggaacctttcagaagtgggcatctgtggtggtgcctcttgggaaggagcagaattacaca
tgccgtgtggagcatgaggggctgcctgagccactttcccagagatgggagccttctcca
tcgaccaactccaacatggaaaccactgtcatttatgtcgtccttggagccatcattgga
actctggccatcattggaattgtagtggctgttgtgaggaagaggaggagaaacacaggt
gggaaaggtgactacacccctgctccaggcagggacagctcccagagctctgatgtgtct
ctcccagattgtaaagcatga

KEGG   Rattus norvegicus (rat): 24988
Entry
24988             CDS       T01003                                 

Gene name
RT1-M2
Definition
(RefSeq) RT1 class Ib, locus M2 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    24988 (RT1-M2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    24988 (RT1-M2)
   04145 Phagosome
    24988 (RT1-M2)
  09143 Cell growth and death
   04218 Cellular senescence
    24988 (RT1-M2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    24988 (RT1-M2)
   04612 Antigen processing and presentation
    24988 (RT1-M2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    24988 (RT1-M2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24988 (RT1-M2)
   05170 Human immunodeficiency virus 1 infection
    24988 (RT1-M2)
   05168 Herpes simplex virus 1 infection
    24988 (RT1-M2)
   05163 Human cytomegalovirus infection
    24988 (RT1-M2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24988 (RT1-M2)
   05169 Epstein-Barr virus infection
    24988 (RT1-M2)
   05165 Human papillomavirus infection
    24988 (RT1-M2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    24988 (RT1-M2)
   05330 Allograft rejection
    24988 (RT1-M2)
   05332 Graft-versus-host disease
    24988 (RT1-M2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    24988 (RT1-M2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    24988 (RT1-M2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24988 (RT1-M2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    24988 (RT1-M2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   24988 (RT1-M2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  24988 (RT1-M2)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 C2-set_2 Med30 DUF3574
Other DBs
NCBI-GeneID: 24988
NCBI-ProteinID: NP_001001717
RGD: 3493
Ensembl: ENSRNOG00000049590
Vega: OTTRNOG00000001421
UniProt: Q6W9J5
Position
20
AA seq 344 aa
METSAILTLHLLLSASLALTQSFKGSHSLRYFDIAVSRPGLEETHYMTLGYVDDTEFVHF
NNEAVNPRFEPRVPWMEQMGQKYWDDQTRIAKVAEQQIRVYFQKLRGYYNQSQNSSHTIQ
RMTGCYIGPDGHLLHAYRQFGYDGQDYLTLNEDLSTWTAADSAAEITHREWKATNEAEFW
RVYLEGPCMVWLFKYLTVGNETLLRADPPKVYVTHHPRPEGDITLRCWALGFYPSDITLI
WQRDGEDLTQDMDVIETRPAGDGTFQKWAAVVVPSGKEQNYTCYVEHEGLPEPLTLRWSR
PPQSFIPTIVVAVGLVLLGASVVTLVIWKKSSGGGRGSLRFLSN
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggagacttcagcaatcctcactctccacctgctgctgagcgcttctttggccctgacc
cagtcctttaaaggctcccactccttgcggtactttgacatcgcagtgtcaaggcctggc
ctagaggagacccactacatgactcttggctacgtggatgacacagagtttgtgcatttc
aacaatgaggcagtgaatccgaggtttgagccccgggtgccctggatggaacagatggga
cagaagtactgggatgaccagacacgaattgccaaagtcgcggaacagcagattagagtg
tactttcagaaactgcgaggctactacaaccagagccagaacagttctcacaccatccaa
aggatgactggctgctacattggaccagacggacacctacttcacgcataccgtcagttt
ggatatgatggacaagattacctcactttgaatgaagatctgagcacctggactgcggca
gattcggcagctgagatcacccatagagagtggaaggcaactaatgaagctgagttctgg
agggtctacttggagggcccttgcatggtgtggctctttaaatacctgacagtgggaaat
gagactctactgcgcgcagatccccccaaagtatatgtgacccatcaccccagacctgaa
ggtgatatcaccctgaggtgctgggccctgggcttctacccttctgacatcaccctgatc
tggcaaagagatggagaggacctgacccaggacatggacgtaattgagaccagacctgca
ggggatggaaccttccagaagtgggcagctgtggtggtgccttcggggaaggagcagaat
tatacatgctatgtagaacatgaggggctgcctgaacccctcaccctgagatggagtaga
cctcctcagtcgttcattcccacaatagtggttgctgttggcctggttctcctgggagct
tctgtggttacacttgtcatttggaagaagagctcaggtggtggaaggggtagcctgaga
tttctttccaactga

KEGG   Rattus norvegicus (rat): 294213
Entry
294213            CDS       T01003                                 

Gene name
RT1-M1-4
Definition
(RefSeq) RT1 class I, locus M1, gene 4 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    294213 (RT1-M1-4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    294213 (RT1-M1-4)
   04145 Phagosome
    294213 (RT1-M1-4)
  09143 Cell growth and death
   04218 Cellular senescence
    294213 (RT1-M1-4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    294213 (RT1-M1-4)
   04612 Antigen processing and presentation
    294213 (RT1-M1-4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    294213 (RT1-M1-4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    294213 (RT1-M1-4)
   05170 Human immunodeficiency virus 1 infection
    294213 (RT1-M1-4)
   05168 Herpes simplex virus 1 infection
    294213 (RT1-M1-4)
   05163 Human cytomegalovirus infection
    294213 (RT1-M1-4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    294213 (RT1-M1-4)
   05169 Epstein-Barr virus infection
    294213 (RT1-M1-4)
   05165 Human papillomavirus infection
    294213 (RT1-M1-4)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    294213 (RT1-M1-4)
   05330 Allograft rejection
    294213 (RT1-M1-4)
   05332 Graft-versus-host disease
    294213 (RT1-M1-4)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    294213 (RT1-M1-4)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    294213 (RT1-M1-4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    294213 (RT1-M1-4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    294213 (RT1-M1-4)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   294213 (RT1-M1-4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  294213 (RT1-M1-4)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_3 ig C2-set_2 MHC_II_alpha
Other DBs
NCBI-GeneID: 294213
NCBI-ProteinID: NP_001008850
RGD: 1359375
UniProt: Q6MFZ2
Position
20
AA seq 341 aa
MKTFVTEALLLLLLAVLALASHPEGSHLFGLFQTLLTRPGHSEPLFISAGFMDNIQFERF
NNRSDFPGMEHCAPWIDHRSPEYWKEHTQRALKDIRFMRQALKLMIHTYNYSATGYHTIQ
RRIGCHVLPRGYFSHGFLELAFNGQDYIMLNEDLRTWTTVGKAAEILRKEWEKHSFAQAM
KIYLEVSCVDSFLTELAYGKEILLRIDPPKVQVIRKVRLNRKITLMCWALSFYPPEITLT
WQRDGCNQMQDMEVVETRPAGDGTFQKWAAVVVSSGEEQRYTCHVNHKGLPEVITMRWEP
PEPIIPITTIVIAVVLGALVVGAVMTFLIWKMTRGKERAWF
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaagacctttgttactgaggctctcctgctgctgctcctagcagtgctggccctggcc
agccatccagaaggttcacatctttttggccttttccaaactctcttgacccggcctgga
cattctgagcccctatttatcagtgctggctttatggataatatacagtttgagaggttc
aacaacagatcagattttcctgggatggagcactgcgcaccatggatagatcatcggagt
ccagagtattggaaggagcacacacagagggccctgaaagatattcggtttatgagacaa
gcactgaaattaatgatccacacctacaactacagtgcaactggatatcacacaatccag
aggaggattggctgccatgtcttgcctagagggtacttcagtcatggattcttagaatta
gccttcaatggccaggattacatcatgctgaatgaagacctgaggacttggaccacagtt
ggcaaggcagctgagattctcaggaaagagtgggagaaacacagttttgcacaagccatg
aagatttatttggaggtttcatgtgtggactcatttctcacagagctggcttatgggaag
gagattttgctgagaatagatccccctaaagtacaagtgatccgcaaggtcagacttaac
aggaaaattaccctgatgtgctgggccctgagtttctaccctcctgaaattaccctgacc
tggcagagagatggatgcaatcagatgcaggacatggaggtggtagagaccaggcctgca
ggggacggaactttccagaaatgggcagctgtggtggtttcttctggggaagagcaaaga
tacacatgtcatgtgaatcataaggggctacctgaggtcatcaccatgaggtgggagcct
cctgagcctatcatcccaattactactattgttattgctgtagttctcggagctctggtt
gtgggagctgtgatgacttttctgatatggaagatgactagaggtaaggaaagggcatgg
ttttag

KEGG   Rattus norvegicus (rat): 294228
Entry
294228            CDS       T01003                                 

Gene name
RT1-S3
Definition
(RefSeq) RT1 class Ib, locus S3 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    294228 (RT1-S3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    294228 (RT1-S3)
   04145 Phagosome
    294228 (RT1-S3)
  09143 Cell growth and death
   04218 Cellular senescence
    294228 (RT1-S3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    294228 (RT1-S3)
   04612 Antigen processing and presentation
    294228 (RT1-S3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    294228 (RT1-S3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    294228 (RT1-S3)
   05170 Human immunodeficiency virus 1 infection
    294228 (RT1-S3)
   05168 Herpes simplex virus 1 infection
    294228 (RT1-S3)
   05163 Human cytomegalovirus infection
    294228 (RT1-S3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    294228 (RT1-S3)
   05169 Epstein-Barr virus infection
    294228 (RT1-S3)
   05165 Human papillomavirus infection
    294228 (RT1-S3)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    294228 (RT1-S3)
   05330 Allograft rejection
    294228 (RT1-S3)
   05332 Graft-versus-host disease
    294228 (RT1-S3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    294228 (RT1-S3)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    294228 (RT1-S3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    294228 (RT1-S3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    294228 (RT1-S3)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   294228 (RT1-S3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  294228 (RT1-S3)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 LapA_dom Ig_2
Other DBs
NCBI-GeneID: 294228
NCBI-ProteinID: NP_001008886
RGD: 735037
Ensembl: ENSRNOG00000000777
Vega: OTTRNOG00000001568
UniProt: Q9QUQ2 F1LQF2
Position
20
AA seq 365 aa
MRMLPPAYLLQLLAGTMVLTQTSSHSLRYFYTALSRPGLGEPRFIVVGYVDDTQFVRYDS
DVENPRMEPRARWMEQEEPAYWERETRKARDTGRNFKVNLRTLLRYYNQSDDESHTLQWM
YGCDVGPDGHLLRGYCQEAYDGRDYISLNEDLRSWTATDMASQASKIKSEEVGEAHHQRA
YLQGPCVEWLHTYLHLGKETLLRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLTWQ
LNGEDLTQDMELVETRPAGDGTFQKWAAVVVPSGEELKYTCHVEHEGLPEPLALRWEPSP
FTDSSMPVIVVLGAVAIIGAVAIIGAVAIIGAVVRRRKRNTGEKGSYAHVLGSKAFQISD
WPQKA
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaggatgttacctcctgcctatttgctccaactactggcaggcaccatggtcctgacc
cagactagctcacactcgctgcggtatttctacaccgccctgtcccggcccggcctcggg
gagcccaggttcattgtcgttggctacgtggacgacacgcagttcgtgcgctatgacagc
gatgtggagaatccgaggatggagccacgggcgcggtggatggagcaggaggagccggca
tattgggagcgggagactcggaaagccagggacaccgggaggaacttcaaagtgaatctg
aggaccctgctccgctactacaatcagagtgacgacgaatctcacacgctgcagtggatg
tacggctgcgacgtggggcccgatgggcacctgctccgcggttattgtcaggaggcttat
gacggccgggattatatctccttgaacgaggacctgcgctcctggaccgcgactgacatg
gcctcacaggcctctaagatcaagtcagaggaagttggtgaggcccatcaccagagggcc
tacctgcaaggtccttgcgtggagtggctccacacatacctacatctgggaaaggagacg
ctgctgcgctcagaccccccaaaggcacatgtgacccttcaccccagacctgaaggtgat
gtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccttgacctggcaa
ttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcctgcaggggat
ggaaccttccagaagtgggcagctgtggtagtgccttctggggaggagctgaagtacaca
tgccatgtggagcatgagggactgcctgaacctctcgccctgagatgggagccttctcca
ttcaccgactccagcatgccagtgattgttgtccttggagctgtggccatcattggagct
gtggccatcattggagctgtggccatcattggagctgttgtgaggaggaggaagagaaac
acaggtgaaaaaggcagctatgctcatgttctaggcagcaaggctttccagatctctgac
tggcctcagaaggcatga

KEGG   Rattus norvegicus (rat): 309584
Entry
309584            CDS       T01003                                 

Gene name
RT1-M4
Definition
(RefSeq) RT1 class Ib, locus M4 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    309584 (RT1-M4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    309584 (RT1-M4)
   04145 Phagosome
    309584 (RT1-M4)
  09143 Cell growth and death
   04218 Cellular senescence
    309584 (RT1-M4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    309584 (RT1-M4)
   04612 Antigen processing and presentation
    309584 (RT1-M4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    309584 (RT1-M4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    309584 (RT1-M4)
   05170 Human immunodeficiency virus 1 infection
    309584 (RT1-M4)
   05168 Herpes simplex virus 1 infection
    309584 (RT1-M4)
   05163 Human cytomegalovirus infection
    309584 (RT1-M4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    309584 (RT1-M4)
   05169 Epstein-Barr virus infection
    309584 (RT1-M4)
   05165 Human papillomavirus infection
    309584 (RT1-M4)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    309584 (RT1-M4)
   05330 Allograft rejection
    309584 (RT1-M4)
   05332 Graft-versus-host disease
    309584 (RT1-M4)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    309584 (RT1-M4)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    309584 (RT1-M4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    309584 (RT1-M4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    309584 (RT1-M4)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   309584 (RT1-M4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  309584 (RT1-M4)
SSDB
Motif
Pfam: MHC_I C1-set
Other DBs
NCBI-GeneID: 309584
NCBI-ProteinID: NP_001161815
RGD: 1562593
Ensembl: ENSRNOG00000060412
UniProt: F1LSU0
Position
20
AA seq 341 aa
MGSVVPRIFFLLLVTSLAPTQAGAGSHSLRYFTTTLYDPGYRKPRFTVVGYVDNTQIVNF
DSHLASQRVEPRVPFIAQDPEHLEELTRLGRGILILGRIELWTLFGYHSQRENESHTVQW
LFGCDIGPDRRLLRGYKHVAYEGQDYISLTEDLRSWVAVDTEEAQITRRKWEASGIATSW
RSFLEGRCVKWLLKYLDKGKEMLQRADPPKTNVAHHPRPEGDVTLRCWALDFYPADIILT
WQRDEEDLTQDMDLVETRPTGNGTFQKWASVVVPSGEEHRYTCHVLHEGLLEPLILRWEP
SPSPTTPIMGIIAGLVLLGVLVTGTVAAIMRRRKSAGKDGV
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggggtccgtggtgccgcgcatcttctttttgctgctggtgacctccctggccccaact
caggctggcgcgggctcacactccctgcggtatttcaccaccaccttgtacgatcctggc
taccgcaaacctcggttcaccgtcgtgggctacgtggacaacacacagatcgtgaacttc
gacagccacttggcgagtcagcgggtggagccgcgggtgccgtttatagcgcaggatcct
gagcatttggaggagctgacacgcctaggcagggggatcttaatacttggccgaatcgaa
ctgtggaccctgttcggttaccatagccagagagagaatgagtctcacactgtccagtgg
ctattcggctgtgacatagggccagaccgtcgcctcctccgtgggtataagcacgttgct
tatgaaggccaggattacatctctctaactgaggacctgcgctcctgggttgcggtggat
accgaggaggctcagatcaccaggcgcaagtgggaggcatctggtattgctacatcatgg
aggtctttcttggagggcaggtgcgtgaagtggcttctcaaatacctggataaagggaag
gagatgctgcagcgtgcagatccccccaaaacaaacgtggctcatcaccctagacctgaa
ggtgatgtcaccctgaggtgctgggccttggacttctaccctgctgacatcatcctgact
tggcaaagggatgaggaggacctgacccaggacatggaccttgtagagaccagacctaca
gggaatggaactttccagaagtgggcatctgtggtggtgccttcaggagaagagcataga
tacacatgccatgtgctgcatgaggggctgcttgagcccctcatcctgagatgggagcct
tcaccctcccccaccactcccatcatggggatcattgctggtctggttctccttggagtt
ttggtcactggaactgtggctgccattatgaggaggaggaagagtgcaggtaaggatggt
gtttga

KEGG   Rattus norvegicus (rat): 309600
Entry
309600            CDS       T01003                                 

Gene name
RT1-CE12
Definition
(RefSeq) RT1 class I, locus CE12 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    309600 (RT1-CE12)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    309600 (RT1-CE12)
   04145 Phagosome
    309600 (RT1-CE12)
  09143 Cell growth and death
   04218 Cellular senescence
    309600 (RT1-CE12)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    309600 (RT1-CE12)
   04612 Antigen processing and presentation
    309600 (RT1-CE12)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    309600 (RT1-CE12)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    309600 (RT1-CE12)
   05170 Human immunodeficiency virus 1 infection
    309600 (RT1-CE12)
   05168 Herpes simplex virus 1 infection
    309600 (RT1-CE12)
   05163 Human cytomegalovirus infection
    309600 (RT1-CE12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    309600 (RT1-CE12)
   05169 Epstein-Barr virus infection
    309600 (RT1-CE12)
   05165 Human papillomavirus infection
    309600 (RT1-CE12)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    309600 (RT1-CE12)
   05330 Allograft rejection
    309600 (RT1-CE12)
   05332 Graft-versus-host disease
    309600 (RT1-CE12)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    309600 (RT1-CE12)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    309600 (RT1-CE12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    309600 (RT1-CE12)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    309600 (RT1-CE12)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   309600 (RT1-CE12)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  309600 (RT1-CE12)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 309600
NCBI-ProteinID: NP_001008835
RGD: 1359103
UniProt: Q6MG32
Position
20
AA seq 371 aa
MGVTAPPLLLLLLAAALARTQTRAGSHSLRYFKTAVSRPGLGEPRFMEVGYVDDTEFVRF
DSDAENPRYEPRARWMEQQGPEYWERETQGAKEKEQTFRVNLRTLLGYYNQSEGDSHTLQ
LMFGCDVGSDGRLLRGYDQFAYDGRDYIALNEDLKTWAAADVVAQMTRNKWERARYAEKR
RANLEGECVESLRRFLELGKETLLRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLT
WQMNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCLVEHEGLPEPLTLRWEP
PSSTNSNMEFNVIYVVLGAISAVAISGAVIIGAVLAVVRKRNTGGEGGDYTPAPDRDSCQ
SSNVSLPDCKA
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgggggtgactgcgccgcccttgctgctcctgctgctggcggccgccttggcccggacc
cagacccgcgcgggctcacactcgctgcggtatttcaaaaccgccgtgtcccggcccggc
ctcggggagccccggttcatggaagtcggctacgtggacgacacggagttcgtgcgcttc
gacagtgacgcggagaatccgagatacgagccgcgggcccggtggatggagcagcagggg
ccggagtattgggagcgggagacgcagggagccaaggaaaaggagcagactttccgagtg
aacctgaggacactgcttggctactacaaccagagcgagggcgactctcacacactccag
ttgatgtttggctgtgacgtggggtcggacgggaggctcctccgcgggtatgatcagttc
gcctacgacggccgcgattacatcgccctgaacgaagacctgaaaacgtgggcggcggcg
gacgtggtggcgcagatgacccgaaacaagtgggagcgggctcgttatgcagagaaacgc
agggccaatctggaaggagagtgtgtggagtcgctccgcagattcctggaactcgggaag
gagacgctgctgcgctcagatcccccaaaggcacatgtgacccttcaccccagacctgaa
ggtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagatgaatggggaggacctgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggtgcctcttgggaaggagcagaat
tacacatgccttgtggagcatgaggggctgcctgagcctctcaccttgagatgggagcct
ccttcatccaccaactccaacatggaattcaatgtcatttatgttgtccttggagccatc
tctgctgtggccatcagtggagctgtgatcattggagctgtgttggctgttgtgaggaag
agaaacacaggtggggaaggaggagactacacccctgctccagacagggacagctgccag
agctctaatgtgtctctcccagattgtaaagcatga

KEGG   Rattus norvegicus (rat): 309603
Entry
309603            CDS       T01003                                 

Gene name
RT1-CE1
Definition
(RefSeq) RT1 class I, locus CE1 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    309603 (RT1-CE1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    309603 (RT1-CE1)
   04145 Phagosome
    309603 (RT1-CE1)
  09143 Cell growth and death
   04218 Cellular senescence
    309603 (RT1-CE1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    309603 (RT1-CE1)
   04612 Antigen processing and presentation
    309603 (RT1-CE1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    309603 (RT1-CE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    309603 (RT1-CE1)
   05170 Human immunodeficiency virus 1 infection
    309603 (RT1-CE1)
   05168 Herpes simplex virus 1 infection
    309603 (RT1-CE1)
   05163 Human cytomegalovirus infection
    309603 (RT1-CE1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    309603 (RT1-CE1)
   05169 Epstein-Barr virus infection
    309603 (RT1-CE1)
   05165 Human papillomavirus infection
    309603 (RT1-CE1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    309603 (RT1-CE1)
   05330 Allograft rejection
    309603 (RT1-CE1)
   05332 Graft-versus-host disease
    309603 (RT1-CE1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    309603 (RT1-CE1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    309603 (RT1-CE1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    309603 (RT1-CE1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    309603 (RT1-CE1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   309603 (RT1-CE1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  309603 (RT1-CE1)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 Ig_2 Insulin_TMD
Other DBs
NCBI-GeneID: 309603
NCBI-ProteinID: NP_001008832
RGD: 1595869
UniProt: Q861Q4
Position
20
AA seq 375 aa
MGVTAPPLLLLLLAAALARTQTRAGSHSLRYFKTAVSRPGLGEPRFMEVGYVDDTEFVRF
DSDAENPRYEPRVRWMERQRPEYWERETQGAKEKEQTFRVNLRTLLGYYNQSEGDSHTLQ
LMFGCDVGSDGRLLRGYDQFAYDGRDYIALNEDLKTWAAADVVAQMTRNKWERARYAEKR
RANLEGECVESLRRYLELGKETLLRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLT
WQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHMEHEGLPEPLTLRWEA
PPSTNSNMEFNVIYVVLGAISAVAIIGAVIIGAVLAVVRKRNTGRKGQGGKGDYAPAPDR
DSCQSSNVSLPDCKA
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgggggtgactgcgccgcccttgctgctcctgctgctggcggccgccttggcccggacc
cagacccgcgctggctcacactcgctgcggtatttcaaaaccgccgtgtcccggccgggc
ctcggggagccccggttcatggaagtcggctatgtggacgacacggagttcgtgcgcttc
gacagtgacgcggagaatccgagatacgagccgcgggtgcggtggatggagcggcagagg
ccggagtattgggagcgggagacgcagggagccaaggaaaaggagcagactttccgagtg
aacctgaggaccctgcttggctactacaaccagagcgagggcgactctcacacactccag
ttgatgtttggctgtgacgtggggtcggacgggaggctcctccgcgggtatgatcagttc
gcctacgacggccgcgattacatcgccctgaacgaagacctgaaaacgtgggcggcggcg
gacgtggtggcgcagatgacccgaaacaagtgggagcgggctcgttatgcagagaaacgc
agggccaatctggaaggagagtgtgtggagtcgctccgcagatacctggaactcgggaag
gagacgctgctgcgctcagatcccccaaaggcacatgtgacccttcaccccagacctgaa
ggtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggtgcctcttgggaaggagcagaat
tacacatgccacatggagcatgaggggctgcctgagcctctcaccttgagatgggaggcc
cctccatccaccaactccaacatggaattcaatgtcatttatgttgtccttggagccatc
tctgctgtggccatcattggagctgtgatcattggagctgtgttggctgttgtgaggaag
agaaacacaggtaggaaagggcagggtgggaaaggagactacgcccctgctccagacagg
gacagctgccagagctctaatgtgtctctcccagattgtaaagcatga

KEGG   Rattus norvegicus (rat): 309607
Entry
309607            CDS       T01003                                 

Gene name
RT1-CE5
Definition
(RefSeq) RT1 class I, locus CE5 isoform 1 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    309607 (RT1-CE5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    309607 (RT1-CE5)
   04145 Phagosome
    309607 (RT1-CE5)
  09143 Cell growth and death
   04218 Cellular senescence
    309607 (RT1-CE5)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    309607 (RT1-CE5)
   04612 Antigen processing and presentation
    309607 (RT1-CE5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    309607 (RT1-CE5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    309607 (RT1-CE5)
   05170 Human immunodeficiency virus 1 infection
    309607 (RT1-CE5)
   05168 Herpes simplex virus 1 infection
    309607 (RT1-CE5)
   05163 Human cytomegalovirus infection
    309607 (RT1-CE5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    309607 (RT1-CE5)
   05169 Epstein-Barr virus infection
    309607 (RT1-CE5)
   05165 Human papillomavirus infection
    309607 (RT1-CE5)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    309607 (RT1-CE5)
   05330 Allograft rejection
    309607 (RT1-CE5)
   05332 Graft-versus-host disease
    309607 (RT1-CE5)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    309607 (RT1-CE5)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    309607 (RT1-CE5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    309607 (RT1-CE5)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    309607 (RT1-CE5)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   309607 (RT1-CE5)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  309607 (RT1-CE5)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 309607
NCBI-ProteinID: NP_001008843
RGD: 1595868
Ensembl: ENSRNOG00000000723
Vega: OTTRNOG00000001808
UniProt: Q861Q0 Q95II0 Q861J1
Position
20
AA seq 370 aa
MGAMAPRTLLLLLAAALAPTRTRAGSHSLRYFHTAVSRPGLGEPRFIIVGYVDHTEFVRY
DSDAENPRYEPRARWMEREGPEYWEQQTQIVKGHEWSFRVSLRNLLGYYNQSEGGSHTLQ
VMSGCDMGSDQSLRRGYEQYAYDGRDYISLNEDLKTWSAADLAAQITLNKWDQAGELDYY
KAYLEGPCLEWLLRYLEHGKETLMRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLT
WQLNGEDLTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCLVEHEGLPEPLTFRWEA
PPSTNSNTGMSVILGTVTIIAVMAIIVVVAVIRTVVRKRWIKTGGKGVYTPAPGRDSSQS
SDVSLPDCKA
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgggggcgatggcaccgcgcacgctgctcctgctgctggcggcggccctggccccaacc
cggacccgcgcgggctcacactcgctgcggtatttccacaccgccgtgtcccggcccggc
ctcggggagccccggttcattatcgtcggctatgtggaccacacggagttcgtgcgctac
gacagcgacgcagagaatccgagatacgagccgcgggcgcggtggatggagcgggagggg
ccggagtattgggagcagcagacacagatcgtcaagggacacgaatggagtttccgagtg
agcctgaggaatctgctaggctactacaaccagagcgagggcggctctcacacactccag
gtgatgtctggatgtgacatggggtcggaccagagcctgcgccgcgggtatgagcaatac
gcctatgacggccgcgattacatctccctgaacgaagacctgaagacgtggtcggctgcg
gacttggcagcacagatcactctaaacaagtgggatcaggctggtgaattagactattac
aaggcctacctggagggtccatgcctggagtggcttctcagatacctggagcacgggaag
gagacactgatgcgctcagatcccccaaaggcacatgtgacccttcaccccagacctgaa
ggtgatgtgaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaat
tacacatgccttgtggagcatgaggggctgcctgagcccctcacctttagatgggaggct
cctccctccaccaactccaacacgggaatgtctgttattcttggaactgtgaccatcatt
gcagttatggccatcattgtagttgtagccgtcattagaactgttgtgaggaagagatgg
ataaaaacaggtggaaaaggagtctacacccctgctccaggcagggacagctcccagagc
tctgatgtgtctctcccagattgtaaagcatga

KEGG   Rattus norvegicus (rat): 309627
Entry
309627            CDS       T01003                                 

Gene name
RT1-A3
Definition
(RefSeq) RT1 class I, locus A3 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    309627 (RT1-A3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    309627 (RT1-A3)
   04145 Phagosome
    309627 (RT1-A3)
  09143 Cell growth and death
   04218 Cellular senescence
    309627 (RT1-A3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    309627 (RT1-A3)
   04612 Antigen processing and presentation
    309627 (RT1-A3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    309627 (RT1-A3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    309627 (RT1-A3)
   05170 Human immunodeficiency virus 1 infection
    309627 (RT1-A3)
   05168 Herpes simplex virus 1 infection
    309627 (RT1-A3)
   05163 Human cytomegalovirus infection
    309627 (RT1-A3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    309627 (RT1-A3)
   05169 Epstein-Barr virus infection
    309627 (RT1-A3)
   05165 Human papillomavirus infection
    309627 (RT1-A3)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    309627 (RT1-A3)
   05330 Allograft rejection
    309627 (RT1-A3)
   05332 Graft-versus-host disease
    309627 (RT1-A3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    309627 (RT1-A3)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    309627 (RT1-A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    309627 (RT1-A3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    309627 (RT1-A3)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   309627 (RT1-A3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  309627 (RT1-A3)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 Herpes_gE DUF2755 Psg1 Ig_2 MHC_I_2 EphA2_TM
Other DBs
NCBI-GeneID: 309627
NCBI-ProteinID: NP_001008830
RGD: 1359610
UniProt: Q9JHM2
Position
20
AA seq 369 aa
MAPRTLLLLLAAALAPTQTQAGSHSLRYFDIAVSRPGLGEPRFIIVGYVDDREVMRFDSD
AENPRMKPRARWMEREGPEYWERQTRKVKEKEQIFRDNLRTLLRYYNQSEGGSHTVQRLS
GCDVGSDGSLLRGYNQHAYDGRDYIALNEDLKTWTAADTAAQITKNKWERDGEAERRRAY
LEGECVEWLRSYLAPRKETLLRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLTWQL
NGEDLTQDMEFVETRPAGDGTFQKWASVVVPSGEEQNYTCLVEHEGLPKPLTQRWEPSPS
TNTNMGIDVTSVVLGAVAVFVVLAIIGAVVCVVRRRRRRRNTGGKGDYTPARGRDSSQSS
DVSLPDCKA
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggcaccccgcacgctgctcctgctgctggcggccgccctggccccgacccagacccag
gcgggctcacactcgctgcggtatttcgacatcgctgtgtcccggcccggcctcggggag
ccccggttcattatcgtcggctacgtggacgacagggaggtcatgcgcttcgacagcgac
gcggagaatccgaggatgaagcctcgggcgcggtggatggagcgggaggggccggagtat
tgggagcggcagacacggaaagtcaaggaaaaggagcagattttccgagacaacctgagg
accctgctccgctactacaaccagagcgagggcggctctcacaccgtccagagattgtct
ggctgtgacgtggggtcggacgggagcctcctccgcgggtataatcagcacgcctacgat
ggccgcgattacatcgccctgaacgaagacctgaaaacgtggacggcggcggacacagcg
gcgcagatcaccaaaaacaagtgggaacgggatggtgaggcagagagacgcagggcctac
ctggagggcgagtgtgtggagtggctccgcagttacctggcacccaggaaggagacgctg
ctgcgctcagatcccccaaaggcacatgtgacccttcaccccagacctgaaggtgatgtc
accctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacctggcagttg
aatggggaggacctgacccaggacatggagtttgtggagaccaggcctgcaggggatgga
accttccagaagtgggcatctgtggtggtgccttctggggaggagcagaattacacatgc
cttgtggagcatgaggggctccctaagccgcttacccagagatgggagccttctccatcc
accaacaccaacatgggaatcgatgttacttctgttgttcttggagctgtggctgtcttt
gtagttttggccatcattggagctgtggtgtgtgttgtgaggaggaggaggaggaggaga
aacacaggtgggaaaggagactacacccctgctcgaggcagggacagctcccagagctct
gatgtgtctctcccagattgtaaagcatga

KEGG   Rattus norvegicus (rat): 360323
Entry
360323            CDS       T01003                                 

Gene name
RT1-N2
Definition
(RefSeq) RT1 class Ib, locus N2 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    360323 (RT1-N2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    360323 (RT1-N2)
   04145 Phagosome
    360323 (RT1-N2)
  09143 Cell growth and death
   04218 Cellular senescence
    360323 (RT1-N2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    360323 (RT1-N2)
   04612 Antigen processing and presentation
    360323 (RT1-N2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    360323 (RT1-N2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    360323 (RT1-N2)
   05170 Human immunodeficiency virus 1 infection
    360323 (RT1-N2)
   05168 Herpes simplex virus 1 infection
    360323 (RT1-N2)
   05163 Human cytomegalovirus infection
    360323 (RT1-N2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    360323 (RT1-N2)
   05169 Epstein-Barr virus infection
    360323 (RT1-N2)
   05165 Human papillomavirus infection
    360323 (RT1-N2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    360323 (RT1-N2)
   05330 Allograft rejection
    360323 (RT1-N2)
   05332 Graft-versus-host disease
    360323 (RT1-N2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    360323 (RT1-N2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    360323 (RT1-N2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    360323 (RT1-N2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    360323 (RT1-N2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   360323 (RT1-N2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  360323 (RT1-N2)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 TMEM154 Shisa Ig_2 Psg1
Other DBs
NCBI-GeneID: 360323
NCBI-ProteinID: NP_001008854
RGD: 1595850
Ensembl: ENSRNOG00000029386
Vega: OTTRNOG00000001578
UniProt: Q6MFZ8 V5ISG7
Position
20
AA seq 377 aa
MLWVPKAGALWLSALLLLLNASFSWTWTPEGSHSLRYFSIVMSWLGLREPRIIVSGCIDD
TEFVRLDTNKEIVSLKPLVPLQEQEGLEYWEQQVHKVKTQEQQSARNLMMLVRFYNKSMD
DFHTLQWQQGCDVGSDGRLLHWYDQLAFDGVDHPTLNKDLRFWTAWTSTVAQISQPELEA
RLKDNCSELLQKYPEKEKERLLRSDPPRAHVTRHPRPEGDVTLRCWALGFYPADITLTWQ
LNGEDLIQEMEFVETRPAGDGTFQKWASVVVPLGKEQKYTCLVEHEGLSEPLTLRWEPTQ
DSTTTIILIILPTVSAIVLCVAAAVAICICLKKKAGERGRHDTRKQMETVPKTLAGLLWM
IRRSRVPLGILRTTELI
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgctctgggttcccaaggctggtgcgctctggctcagtgcccttctcctgctcctgaat
gcctccttctcctggacttggacccctgagggctcacactccctgcggtatttctccatt
gtcatgtcctggctgggcctccgggagccacggatcatagtcagcggctgcatagatgat
acggagttcgtgcgcttggacaccaacaaggagattgtaagcctgaagcccctagtgcct
ttgcaggagcaggaggggctagagtactgggagcagcaggttcataaagtcaagactcaa
gaacaacagtctgcaaggaacctgatgatgctggttcgtttttacaataagagcatggac
gacttccacacactacagtggcagcaaggctgcgatgtggggtcagatgggcgcctgctt
cactggtacgaccagctcgcctttgatggtgtagatcaccccaccctgaacaaagacctg
cgtttctggacagcgtggaccagcactgtagctcagatatctcagcctgagttagaagct
cgcctgaaggacaactgctcagagctgctgcagaaatacccagaaaaggaaaaggagagg
ctgctgcgttcagacccgccacgggcacatgtgacccggcaccccagacctgaaggtgat
gtcaccctgaggtgctgggccctgggtttctaccctgctgacatcaccctgacctggcag
ttgaatggggaggacctgatccaagaaatggagtttgtggagaccaggcctgcaggggat
ggaaccttccagaagtgggcatctgtggtggtgcccctagggaaggagcagaagtacaca
tgccttgtggagcatgaggggctgtcagagccgctcaccctgagatgggagcctacccag
gattccaccactacaatcattctaattattctacccactgtctctgcaattgtcctctgt
gttgctgctgctgtggcaatttgcatatgcctgaagaagaaggcaggtgaaagaggaagg
cacgacaccaggaagcagatggagacagtccccaagactcttgcaggattgttgtggatg
atcaggagatcgagggtccctcttggaatactgagaactacagaactcatctag

KEGG   Rattus norvegicus (rat): 361787
Entry
361787            CDS       T01003                                 

Gene name
RT1-T24-1
Definition
(RefSeq) RT1 class I, locus T24, gene 1
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    361787 (RT1-T24-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    361787 (RT1-T24-1)
   04145 Phagosome
    361787 (RT1-T24-1)
  09143 Cell growth and death
   04218 Cellular senescence
    361787 (RT1-T24-1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    361787 (RT1-T24-1)
   04612 Antigen processing and presentation
    361787 (RT1-T24-1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    361787 (RT1-T24-1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    361787 (RT1-T24-1)
   05170 Human immunodeficiency virus 1 infection
    361787 (RT1-T24-1)
   05168 Herpes simplex virus 1 infection
    361787 (RT1-T24-1)
   05163 Human cytomegalovirus infection
    361787 (RT1-T24-1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    361787 (RT1-T24-1)
   05169 Epstein-Barr virus infection
    361787 (RT1-T24-1)
   05165 Human papillomavirus infection
    361787 (RT1-T24-1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    361787 (RT1-T24-1)
   05330 Allograft rejection
    361787 (RT1-T24-1)
   05332 Graft-versus-host disease
    361787 (RT1-T24-1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    361787 (RT1-T24-1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    361787 (RT1-T24-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    361787 (RT1-T24-1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    361787 (RT1-T24-1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   361787 (RT1-T24-1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  361787 (RT1-T24-1)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2 MHC_I_2
Other DBs
NCBI-GeneID: 361787
NCBI-ProteinID: NP_001008858
RGD: 1359499
Ensembl: ENSRNOG00000032596
Vega: OTTRNOG00000001580
UniProt: Q6MG05
Position
20
AA seq 330 aa
MWSLIFCFLSHPQDTGARSHSLHYSYSAVTEPGPGVPAFFASGFVDNQTFIHYDSRKMEA
EPCADWLRENPYYFDEETQVFTNQMKIFQLSLRNIQQYYNSSGDRSHRADGFHQQAGPHT
LQFTYGCEMQGNRTTGHWQYGYDGRDYLTLDLDSMQYTAATFIAGYTKHKWQNNEYWLER
EKTYLEKECVLWLKRYLTMGGENFTRTDPPQTTVTHHPRPEGDVTLRCWALGFYPADITL
TWQLNGEDLTQDMELVETRPTGDGTFQKWAAVVVPLGKEQKYTCHVEHEGLPEPLTQRWE
APPGTDSNMGINVIAVFFKLWPSLQLWPSS
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtggtctctgatcttctgcttcctgagccacccccaagacactggagcccgatcacac
tctctgcactattcttactcagccgtgacggagccgggcccaggagttcctgcatttttt
gccagtggctttgtagataaccagaccttcatccactatgacagtaggaagatggaggca
gagccttgtgctgactggctgagggaaaatccatattactttgatgaggagacccaggtt
ttcaccaatcagatgaagatcttccagttgagcctgagaaacattcagcaatactacaac
agctctggtgaccggagtcacagagcagacggcttccaccagcaagcaggccctcacacc
ctccaattcacgtacggctgtgagatgcagggcaacaggaccacagggcactggcagtat
ggctacgatggcagagattacctgaccttggacttggactctatgcaatatacagcagcc
accttcattgctggctacaccaagcacaagtggcaaaacaatgagtactggttggagaga
gagaagacctacttggagaaggagtgtgtcctgtggctaaagagatacttaactatggga
ggagagaactttacccgaactgaccctccacagacaacagtgacacaccaccccagacct
gaaggtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctg
acctggcagttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcct
acaggggatggaaccttccagaagtgggcagctgtggtggtgcctcttgggaaggagcag
aagtacacatgccatgtggagcatgaggggctgcctgagccgcttacccagagatgggag
gctcctccaggcactgactccaacatgggaatcaatgttattgctgttttcttcaagctg
tggccatcattgcagctgtggccatcatcatag

KEGG   Rattus norvegicus (rat): 365527
Entry
365527            CDS       T01003                                 

Gene name
RT1-M6-2
Definition
(RefSeq) RT1 class I, locus M6, gene 2 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    365527 (RT1-M6-2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    365527 (RT1-M6-2)
   04145 Phagosome
    365527 (RT1-M6-2)
  09143 Cell growth and death
   04218 Cellular senescence
    365527 (RT1-M6-2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    365527 (RT1-M6-2)
   04612 Antigen processing and presentation
    365527 (RT1-M6-2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    365527 (RT1-M6-2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    365527 (RT1-M6-2)
   05170 Human immunodeficiency virus 1 infection
    365527 (RT1-M6-2)
   05168 Herpes simplex virus 1 infection
    365527 (RT1-M6-2)
   05163 Human cytomegalovirus infection
    365527 (RT1-M6-2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    365527 (RT1-M6-2)
   05169 Epstein-Barr virus infection
    365527 (RT1-M6-2)
   05165 Human papillomavirus infection
    365527 (RT1-M6-2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    365527 (RT1-M6-2)
   05330 Allograft rejection
    365527 (RT1-M6-2)
   05332 Graft-versus-host disease
    365527 (RT1-M6-2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    365527 (RT1-M6-2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    365527 (RT1-M6-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    365527 (RT1-M6-2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    365527 (RT1-M6-2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   365527 (RT1-M6-2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  365527 (RT1-M6-2)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig
Other DBs
NCBI-GeneID: 365527
NCBI-ProteinID: NP_001008853
RGD: 1595815
Ensembl: ENSRNOG00000040052
UniProt: Q6MFY3
Position
20
AA seq 332 aa
MGAPVLHATLLLLSAFLALTQTKNQSFAGSHSRQYLVTATTSRPGLRDPHVFIVGYVDHM
PFMRFDSDGVAQRIQARGPWVKQMGPEYLEMERKNAERYSHRARENLRFAIQVYNQSDKG
HHRHAFDGQHYISLNSDLTTWSVADSTAQITKRRWEADGVAEAFSHFLKVSCVEWLQKHL
ETGKETLQRSDPPKTHVTHHPRPEGDATLRCWALDFYPADITLTWQEEEEEEELTQDMEL
VETRPAGDGTFQKWASVVVPSGEEQKYTCHVYHEGLPEPLTLRWKPATWPVVGITVGVVL
LGFVTIGALIAIVTMRKKRADPVDPVDLMDPV
NT seq 999 nt   +upstreamnt  +downstreamnt
atgggggctccagtgctgcatgccaccctcctgctgctctcagccttcctggctctgacc
caaaccaagaaccagagttttgctggttcacactccaggcagtatttggtaaccgcgacc
acgtctcgaccgggtcttagagatccccatgtcttcattgttggctatgtggaccacatg
ccatttatgcgctttgacagtgatggagttgctcagaggatccaggcaagaggaccttgg
gtgaagcagatggggcctgagtatttggaaatggagagaaagaatgcggagaggtattca
cacagggctcgagaaaacctgcgattcgcaatccaggtctataaccagagcgataaaggg
catcatagacatgcttttgacggccaacattacatcagcctgaactcggacctgacaaca
tggagtgtcgcagacagcacagctcagatcaccaagcgacggtgggaggcagatggtgta
gcagaggccttcagtcacttcttgaaagtctcttgtgttgaatggctgcagaagcacttg
gagacagggaaggagactctacagcgctcagatcccccaaagacacatgtgacccatcac
cccagacctgaaggtgatgccaccctgaggtgttgggccctggacttctaccctgctgac
atcaccctgacctggcaggaggaggaggaggaggaggaactgacacaggacatggagctt
gtggagaccaggcctgcaggggatggaaccttccagaagtgggcatctgtggtggtgcct
tctggggaggagcagaaatacacttgtcatgtgtaccatgaggggctgcctgagcccctc
acactgagatggaaaccagcaacttggcctgtggttggaataactgttggtgtagttctc
cttgggtttgtcaccattggagctctgattgccattgtgaccatgaggaagaagagagca
gaccctgtggatcctgtggaccttatggatccagtgtga

KEGG   Rattus norvegicus (rat): 368153
Entry
368153            CDS       T01003                                 

Gene name
RT1-CE7
Definition
(RefSeq) RT1 class I, locus CE7 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    368153 (RT1-CE7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    368153 (RT1-CE7)
   04145 Phagosome
    368153 (RT1-CE7)
  09143 Cell growth and death
   04218 Cellular senescence
    368153 (RT1-CE7)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    368153 (RT1-CE7)
   04612 Antigen processing and presentation
    368153 (RT1-CE7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    368153 (RT1-CE7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    368153 (RT1-CE7)
   05170 Human immunodeficiency virus 1 infection
    368153 (RT1-CE7)
   05168 Herpes simplex virus 1 infection
    368153 (RT1-CE7)
   05163 Human cytomegalovirus infection
    368153 (RT1-CE7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    368153 (RT1-CE7)
   05169 Epstein-Barr virus infection
    368153 (RT1-CE7)
   05165 Human papillomavirus infection
    368153 (RT1-CE7)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    368153 (RT1-CE7)
   05330 Allograft rejection
    368153 (RT1-CE7)
   05332 Graft-versus-host disease
    368153 (RT1-CE7)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    368153 (RT1-CE7)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    368153 (RT1-CE7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    368153 (RT1-CE7)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    368153 (RT1-CE7)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   368153 (RT1-CE7)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  368153 (RT1-CE7)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 C2-set_2 Insulin_TMD
Other DBs
NCBI-GeneID: 368153
NCBI-ProteinID: NP_001008845
RGD: 1595786
Ensembl: ENSRNOG00000031090
Vega: OTTRNOG00000001727
UniProt: Q861P9
Position
20
AA seq 355 aa
MGSRAPHTLLLLLAAALARTQPRAGSHSLRYFTTALSRPGLGEPRFISVGYVDDTEFVRF
DSDAENPRYEPRAPWMEREGLEYWEQQTRRAKGNQQTFQVNLRTALHYYNQSEDRSHTIQ
RMYGCDVGSDGSLLRGYEQSAYDGRDYIALNEDLKTWTAADVAAQITRNKWDQAGVAERR
RAYLEGTCMKWLRRYLEHGKETLLRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLT
WQLNGEDLTQDMELVETRPAGDGTFQKWASVVVPPGKEQNYTCRVEHEGLPEPLTLRWEA
PPSTDSNMETNVIYVVIGAISAVAIIGAVLAVVRKKNTGGTGGDYTPAPGQPQQL
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggggtcaagggcacctcacactctgcttctgctgctggcggccgccctggcccggacc
cagccccgcgcgggctcgcactcgctgcggtatttcaccacggcgctgtcccggcccggc
ctcggggagccccggttcatctctgtcggctacgtggacgacacggagttcgtgcgcttc
gacagcgacgcggagaatccgagatacgagccgcgggcgccgtggatggagcgggagggg
ctggagtattgggagcagcagacacggagagccaagggcaaccagcagactttccaagtg
aacctgaggaccgcgctccactactacaaccagagcgaggaccgctctcacaccatccag
aggatgtatggctgtgacgtggggtcggacgggagcctcctccgcgggtatgagcagtcc
gcctacgatggccgcgattatatcgccctgaacgaagacctgaagacctggacagcagca
gacgtggctgcgcagatcacccggaacaagtgggatcaggctggtgttgcagagagacgc
agggcctacctggagggcacatgcatgaagtggctccgcagatacctggagcatgggaag
gagacgctgctgcgctcagatcccccaaaggcacatgtgacccttcaccccagacctgaa
ggtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtgcctcctgggaaggagcagaat
tacacatgccgtgtggagcatgaggggctgcctgagcccctcaccttgagatgggaggct
cctccatccactgactccaacatggaaaccaatgtcatttatgttgtcattggagccatc
tctgctgtggccatcattggagctgtgttggctgttgtgaggaagaaaaacacaggagga
acaggaggagactacacccctgctccaggccagccccaacagctgtga

KEGG   Rattus norvegicus (rat): 406194
Entry
406194            CDS       T01003                                 

Gene name
RT1-T18
Definition
(RefSeq) RT1 class Ib, locus T18 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    406194 (RT1-T18)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    406194 (RT1-T18)
   04145 Phagosome
    406194 (RT1-T18)
  09143 Cell growth and death
   04218 Cellular senescence
    406194 (RT1-T18)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    406194 (RT1-T18)
   04612 Antigen processing and presentation
    406194 (RT1-T18)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    406194 (RT1-T18)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    406194 (RT1-T18)
   05170 Human immunodeficiency virus 1 infection
    406194 (RT1-T18)
   05168 Herpes simplex virus 1 infection
    406194 (RT1-T18)
   05163 Human cytomegalovirus infection
    406194 (RT1-T18)
   05167 Kaposi sarcoma-associated herpesvirus infection
    406194 (RT1-T18)
   05169 Epstein-Barr virus infection
    406194 (RT1-T18)
   05165 Human papillomavirus infection
    406194 (RT1-T18)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    406194 (RT1-T18)
   05330 Allograft rejection
    406194 (RT1-T18)
   05332 Graft-versus-host disease
    406194 (RT1-T18)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    406194 (RT1-T18)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    406194 (RT1-T18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    406194 (RT1-T18)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    406194 (RT1-T18)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   406194 (RT1-T18)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  406194 (RT1-T18)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 HCV_NS4a
Other DBs
NCBI-GeneID: 406194
NCBI-ProteinID: NP_001002821
RGD: 1303092
UniProt: Q6MFZ7
Position
20
AA seq 349 aa
MGNMVPSALLLLLATSPGETQTCSGSHSLRYFYTALSRPAPGESWYIAVGYVDDTQFVRF
NSAGESARYKLRASWVEQEGPEYWQKETEIVTSNAQFFRGNLQTMLDYYNLSHDGSHIIQ
VMYGCDVESDGSLLRGYEQYAYDGRDYITLNEDLKTWTAEDRAAQITRLKWEQAGYAELR
RTYLEGPCKDSLLRYLENRKEMLQCTDPPKAHVSHHPGHEGDVTLRCWALGFYPADITLI
WKKEEEELNQEMELIQTRPAGDGTFQKWAALVVPSGEEQKYTCHVYHEGLPEPLTLRWEP
PQSRMRTRVIVGAVLGAMAILGFMTGGAVMCMRKNKGGDRDYDPAAVTM
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgggaaacatggtgcccagcgccctccttctcctcctggcgacgtcgccaggcgagacc
cagacctgctcagggtcacactctctgcggtatttctacaccgccctgtcccgacctgca
cccggcgagtcctggtacatcgctgtgggctacgtggacgacacacagttcgtgcgcttc
aacagcgcaggggagagtgcgagatataagctacgtgcgtcctgggtggagcaggagggc
cccgagtattggcagaaggagacagagatcgtcacaagcaatgcacagtttttccgagga
aacctacagaccatgcttgactactacaacctgagccacgacggctctcacatcatccag
gtgatgtatggctgtgacgtggaatccgatgggagcctcctccgcggttatgagcagtat
gcctacgatggccgagattacatcaccctcaacgaagatcttaagacttggacagcagag
gacagggcggcgcagatcaccagactcaagtgggagcaggctggttatgcagagctccgc
aggacctacttagagggcccatgcaaggattcgctgctcagatacctagagaatagaaaa
gagatgctgcagtgtacagatcctccaaaggcacatgtgagccatcaccccggacatgaa
ggtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcactctgatc
tggaagaaggaggaggaggaactgaaccaagagatggagcttatacagaccaggcctgca
ggggatgggacttttcagaagtgggcagctctggtggtgccttctggggaggagcagaag
tacacatgtcatgtgtaccatgaggggctacctgagcccctcaccctgagatgggagcct
cctcagtccagaatgcggaccagggtcattgttggtgctgtccttggtgctatggccatc
ttaggttttatgactggaggtgctgtgatgtgcatgagaaagaacaagggaggagacaga
gattatgatcctgctgccgtcacaatgtga

KEGG   Rattus norvegicus (rat): 414270
Entry
414270            CDS       T01003                                 

Gene name
RT1-CE14
Definition
(RefSeq) RT1 class I, locus CE14 isoform 1 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    414270 (RT1-CE14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414270 (RT1-CE14)
   04145 Phagosome
    414270 (RT1-CE14)
  09143 Cell growth and death
   04218 Cellular senescence
    414270 (RT1-CE14)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    414270 (RT1-CE14)
   04612 Antigen processing and presentation
    414270 (RT1-CE14)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    414270 (RT1-CE14)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414270 (RT1-CE14)
   05170 Human immunodeficiency virus 1 infection
    414270 (RT1-CE14)
   05168 Herpes simplex virus 1 infection
    414270 (RT1-CE14)
   05163 Human cytomegalovirus infection
    414270 (RT1-CE14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    414270 (RT1-CE14)
   05169 Epstein-Barr virus infection
    414270 (RT1-CE14)
   05165 Human papillomavirus infection
    414270 (RT1-CE14)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    414270 (RT1-CE14)
   05330 Allograft rejection
    414270 (RT1-CE14)
   05332 Graft-versus-host disease
    414270 (RT1-CE14)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    414270 (RT1-CE14)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    414270 (RT1-CE14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    414270 (RT1-CE14)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    414270 (RT1-CE14)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414270 (RT1-CE14)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  414270 (RT1-CE14)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 414270
NCBI-ProteinID: NP_001008837
RGD: 1359342
UniProt: Q6MG30
Position
20
AA seq 350 aa
MVPPKLLPLLAAVLAPTQTQGGECRSHSLRYFKTAVSRPGLGEPRFMEVGYVDDTEFVRF
DSDAENPRYEPRARWMEQQGPEYWERETQGAKEKEQTFRVNLRTLLGYYNQSEGDSHTLQ
LMFGCDVGSDGSLLRGYDQFAYDGRDYIALNEDLKTWAAADVVAQMTRNKWERARYAEKR
RANLEGECVESLRRYLELGKETLLRSDPPKAHVTLHPRPEGDVTLRCWALGFYPAEITLT
WQLNGEDLSQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCLVEHEGLPEPLTLRWEL
PPSTDSNMETNVIYVVFGAVTIIGAVAIIGAVAIIGVCVRRRRRRNIGGI
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggtgccgcccaagctgctcccactgctggccgctgtcctggccccgactcagactcaa
ggcggtgagtgccgctcacactcgctgcggtatttcaaaaccgccgtgtcccggcccggc
ctcggggagccccggttcatggaagtcggctacgtggacgacacggagttcgtgcgcttc
gacagcgacgcggagaatccgagatacgagccgcgggcccggtggatggagcagcagggg
ccggagtattgggagcgggagacgcagggagccaaggaaaaggagcagactttccgagtg
aacctgaggaccctgcttggctactacaaccagagcgagggcgactctcacacactccag
ttgatgtttggctgtgacgtggggtcggacgggagcctcctccgcgggtatgatcagttc
gcctacgacggccgcgattacatcgccctgaacgaagacctgaaaacctgggcggcggcg
gacgtggtggcgcagatgacccgaaacaagtgggagcgggctcgttatgcagagaaacgc
agggccaacctggaaggcgagtgtgtggagtcgctccgcagatacctggaactcgggaag
gagacgctgctgcgctcagatcccccaaaggcacatgtgacccttcaccccagacctgaa
ggtgatgtcactctgaggtgctgggccctgggcttttaccctgctgaaatcaccctgacc
tggcagttgaatggggaggatctgagccaggacatggaacttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaat
tacacatgccttgtggagcatgaggggctgcctgagcctctcaccctgagatgggagctg
cctccatccaccgactccaacatggaaaccaatgttatttatgttgtctttggagctgtg
accatcattggagctgtggccatcattggagctgtggccatcattggagtttgtgtgagg
aggagaaggaggagaaacataggtggaatatga

KEGG   Rattus norvegicus (rat): 414779
Entry
414779            CDS       T01003                                 

Gene name
RT1-CE2
Definition
(RefSeq) RT1 class I, locus CE2 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    414779 (RT1-CE2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414779 (RT1-CE2)
   04145 Phagosome
    414779 (RT1-CE2)
  09143 Cell growth and death
   04218 Cellular senescence
    414779 (RT1-CE2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    414779 (RT1-CE2)
   04612 Antigen processing and presentation
    414779 (RT1-CE2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    414779 (RT1-CE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414779 (RT1-CE2)
   05170 Human immunodeficiency virus 1 infection
    414779 (RT1-CE2)
   05168 Herpes simplex virus 1 infection
    414779 (RT1-CE2)
   05163 Human cytomegalovirus infection
    414779 (RT1-CE2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    414779 (RT1-CE2)
   05169 Epstein-Barr virus infection
    414779 (RT1-CE2)
   05165 Human papillomavirus infection
    414779 (RT1-CE2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    414779 (RT1-CE2)
   05330 Allograft rejection
    414779 (RT1-CE2)
   05332 Graft-versus-host disease
    414779 (RT1-CE2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    414779 (RT1-CE2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    414779 (RT1-CE2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    414779 (RT1-CE2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    414779 (RT1-CE2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414779 (RT1-CE2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  414779 (RT1-CE2)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig Psg1 DUF2755 C2-set_2
Other DBs
NCBI-GeneID: 414779
NCBI-ProteinID: NP_001008840
RGD: 1598235
UniProt: Q861Q3
Position
20
AA seq 365 aa
MAPRTLLLLLAAALARTQTREGSHSLRYFKTAVSRPGLGKPLFMEVGYVDDTEFVRFDSD
AENPRMEPRARWMEREGPEYWDRETRIAKGNEQRFRVHLRTLLGHYNQSEGGSHTFQLMY
GCDLGSDGSLLRGYDHYAYDGRDYIALNEDLKTWTAADAAARITLNQWHQTGYAERRRAD
LEGECVESLRRYLELGKETLLRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITMTWLL
NGEDLSQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCLVEHEGLPEPLSQRWEPSPS
TDSNMGIDVTSVLPGAVAVFVVLAIIGAVVAIVRRRNTGGKGDYAPAPGRDSSQSSDVSF
SDCKA
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggcgccgcgcacgctgctcttgcttctggccgcagccctggcccggacccagacccgg
gagggctcacactcgctgcggtatttcaaaaccgccgtgtcccggcccggcctcgggaag
cccttgttcatggaagtcggctacgtggacgacacggagttcgtgcgcttcgacagcgac
gcggagaatccgaggatggagccgcgggcgcggtggatggagcgggaggggccggagtat
tgggatcgggagacacggatcgccaagggaaatgagcagaggttccgagtgcacctgagg
accctgcttggccactacaaccagagcgagggcggctctcacaccttccagttgatgtat
ggctgtgacctggggtcggacgggagcctcctacgcgggtatgatcactacgcctacgat
ggccgcgattacatcgccctgaacgaagacctgaagacttggacggcggcggacgcggcg
gcacggatcaccctgaaccagtggcatcagactggttatgcagagagacgcagggccgac
ctggagggcgagtgcgtggagtcactccgcagatacctggagctcgggaaggagacgctg
ctgcgctcagatcccccaaaggcacatgtgacccttcaccccagacctgaaggtgatgtc
accctgaggtgctgggccctgggattctaccctgctgacatcaccatgacctggctgttg
aatggggaggacctgagccaggacatggagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaattacacttgc
cttgtggagcatgaggggctgcctgagccgctttcccagagatgggagccttctccatcc
accgactccaacatgggaattgatgttacttctgttcttcctggagctgtggctgtcttt
gtagttttggccatcattggagctgtggtggctattgtgaggaggagaaacacaggtggg
aaaggagactacgcccctgctccaggcagggacagctcccagagctctgatgtgtctttc
tcagattgtaaagcatga

KEGG   Rattus norvegicus (rat): 414783
Entry
414783            CDS       T01003                                 

Gene name
RT1-CE4
Definition
(RefSeq) RT1 class I, locus CE4 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    414783 (RT1-CE4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414783 (RT1-CE4)
   04145 Phagosome
    414783 (RT1-CE4)
  09143 Cell growth and death
   04218 Cellular senescence
    414783 (RT1-CE4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    414783 (RT1-CE4)
   04612 Antigen processing and presentation
    414783 (RT1-CE4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    414783 (RT1-CE4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414783 (RT1-CE4)
   05170 Human immunodeficiency virus 1 infection
    414783 (RT1-CE4)
   05168 Herpes simplex virus 1 infection
    414783 (RT1-CE4)
   05163 Human cytomegalovirus infection
    414783 (RT1-CE4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    414783 (RT1-CE4)
   05169 Epstein-Barr virus infection
    414783 (RT1-CE4)
   05165 Human papillomavirus infection
    414783 (RT1-CE4)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    414783 (RT1-CE4)
   05330 Allograft rejection
    414783 (RT1-CE4)
   05332 Graft-versus-host disease
    414783 (RT1-CE4)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    414783 (RT1-CE4)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    414783 (RT1-CE4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    414783 (RT1-CE4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    414783 (RT1-CE4)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414783 (RT1-CE4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  414783 (RT1-CE4)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 DUF2755 Marek_A
Other DBs
NCBI-GeneID: 414783
NCBI-ProteinID: NP_001008842
RGD: 1598234
Ensembl: ENSRNOG00000039744
Vega: OTTRNOG00000001812
UniProt: Q861Q1
Position
20
AA seq 373 aa
MGAMAPPTLLLLVAAALTPTKTRAGSHSLRYFHTAVSRPGLGEPRFISVGYVDDTEFVRY
DSDAENPRYEPRARWMEREGPEYWERQTQIAKRNEQVYRVDLSTLRGYYNQSEGGSHTYQ
RMHGCELGSDGSLLRGYMQYAYDGRDYIALNEDLKTWMVKDTAARITRNKWDQAGFGERK
RTYLQVECLEWLRKYLELGKETLLRSDPPKVHVTLHPRPEGGVTLRCWALGFYPADITLT
WQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPSGEEQKYTCHVEHEGLPEPLTQRWEA
PPGTDSNMETNVIYVFFGAVAMIGAVAVIGAVVAVVRRRRRRKRNTGGKGDYAPAPGSDS
CQSSDVSLADCEA
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgggggcgatggcgccgcccacgctgctcctgcttgttgcggccgccctgaccccgacc
aagacgcgcgccggctcacactcgctgcggtatttccacaccgccgtgtcccggcccggc
ctcggggagccccggttcatctctgtcggctacgtggacgacacggagttcgtgcgctac
gatagcgacgcggagaatccgagatatgagccgcgggcgcggtggatggagcgggagggg
ccggagtattgggagaggcagacacagatcgccaagagaaacgagcaggtttaccgagtg
gacctgagtaccctgcgaggctactataaccagagcgagggcggctctcacacctaccag
aggatgcatggctgtgagttggggtcggacgggagcctcctccgcgggtatatgcagtac
gcctatgacggccgcgattacatcgccctgaacgaagacctcaaaacgtggatggtgaag
gacacagcagcacggatcaccagaaacaagtgggatcaggctggttttggagagagaaag
aggacctacctgcaggtcgagtgcttggagtggctccgcaaatacctggagctcgggaag
gagacactgctgcgctcagatccccctaaggtacatgtgacccttcaccccagacctgaa
ggtggtgtcaccctgaggtgctgggctctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggtgccttctggggaggagcagaag
tacacatgccatgtggagcatgaggggctgcctgagccacttacccagagatgggaggct
cctccaggcactgactccaacatggaaaccaatgttatttatgttttctttggagctgtg
gccatgattggggctgtggctgtgattggagctgtggtggctgttgtgaggaggaggagg
aggaggaagagaaacacaggtgggaaaggagactacgcccctgctccaggcagtgacagc
tgccagagctctgatgtgtccctcgcagattgtgaagcatga

KEGG   Rattus norvegicus (rat): 414784
Entry
414784            CDS       T01003                                 

Gene name
RT1-T24-4
Definition
(RefSeq) RT1 class I, locus T24, gene 4
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    414784 (RT1-T24-4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414784 (RT1-T24-4)
   04145 Phagosome
    414784 (RT1-T24-4)
  09143 Cell growth and death
   04218 Cellular senescence
    414784 (RT1-T24-4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    414784 (RT1-T24-4)
   04612 Antigen processing and presentation
    414784 (RT1-T24-4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    414784 (RT1-T24-4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414784 (RT1-T24-4)
   05170 Human immunodeficiency virus 1 infection
    414784 (RT1-T24-4)
   05168 Herpes simplex virus 1 infection
    414784 (RT1-T24-4)
   05163 Human cytomegalovirus infection
    414784 (RT1-T24-4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    414784 (RT1-T24-4)
   05169 Epstein-Barr virus infection
    414784 (RT1-T24-4)
   05165 Human papillomavirus infection
    414784 (RT1-T24-4)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    414784 (RT1-T24-4)
   05330 Allograft rejection
    414784 (RT1-T24-4)
   05332 Graft-versus-host disease
    414784 (RT1-T24-4)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    414784 (RT1-T24-4)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    414784 (RT1-T24-4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    414784 (RT1-T24-4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    414784 (RT1-T24-4)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414784 (RT1-T24-4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  414784 (RT1-T24-4)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 Marek_A DAP10 Ig_2 Insulin_TMD
Other DBs
NCBI-GeneID: 414784
NCBI-ProteinID: NP_001008826
RGD: 1598233
Ensembl: ENSRNOG00000042905
Vega: OTTRNOG00000001565
UniProt: Q4G002
Position
20
AA seq 373 aa
MWALIFCFLSHPRDTGARSHSLHYSYSAVTEPGPGVPAFFASGFVDNQPFIHYDSRKMEA
EPCADWLRENPYYFDEETQVFTNRMKIFQLSLRNIQQYYNSSGDRSQRADGFHQQAGPHT
LQFTYGCEMQDNRTTGHWQYGYDGRDYLTLDLDSMQYTAATFIAGYTKHKWQNNEYWLER
EKTYLEKECVLWLKRYLTMGGENFTRTDPPQTTVTHHPRPEGDVTLRCWALGFYPADITL
TWQLNGEDLTQEMELVETRPAGDGTFQKWASVVVPLGKEQKYTCHVEHEGLPEPLTQRWE
PPSSTDSNMETNVIYVVVGAVSAVAIIGAVIIGAVVAVVRKRRRNTGGKGVYAPAPGRDS
CQSSDVSLPDCEA
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgtgggctctgatcttctgcttcctgagtcacccccgagacactggagcccgatcacac
tctctgcactattcttactcagccgtgacagagccgggcccaggagttcctgcatttttt
gccagtggctttgtagataaccagcccttcatccactatgacagtaggaagatggaggca
gagccttgtgctgactggctgagggaaaatccatattactttgatgaggagacccaggtt
ttcaccaatcggatgaagatcttccagttgagcctgagaaacattcagcaatactacaac
agctctggtgaccggagtcagagagcagatggcttccaccagcaagcaggccctcacacc
ctccagttcacgtacggctgtgagatgcaggacaacaggaccacagggcactggcagtat
ggctacgatggcagggattacctgaccttggacttggactctatgcaatatacagcagcc
accttcattgctggctacaccaagcacaagtggcaaaacaatgagtactggctggagaga
gagaagacctacttggagaaggagtgtgtcctgtggctaaagagatacttaactatggga
ggagagaactttacccgaactgaccctccacagacaacagtgacacaccaccccagacct
gaaggtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctg
acctggcagttgaatggggaggacctgacccaggaaatggagcttgtggagaccaggcct
gcaggggatggaaccttccagaagtgggcatctgtggtggtgcctcttgggaaggagcag
aagtacacatgccatgtggagcatgaggggctgcctgagccgcttacccagagatgggag
cctccttcatccactgattccaacatggaaaccaatgtcatttatgttgtcgttggagcc
gtctctgctgtggccattattggagctgtgatcattggagctgtggtggctgttgtgagg
aagaggaggagaaacacaggtgggaaaggagtctacgcccctgctccaggcagggacagc
tgccagagctctgatgtgtctctcccagattgtgaagcatga

KEGG   Rattus norvegicus (rat): 414785
Entry
414785            CDS       T01003                                 

Gene name
RT1-M6-1
Definition
(RefSeq) RT1 class I, locus M6, gene 1 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    414785 (RT1-M6-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414785 (RT1-M6-1)
   04145 Phagosome
    414785 (RT1-M6-1)
  09143 Cell growth and death
   04218 Cellular senescence
    414785 (RT1-M6-1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    414785 (RT1-M6-1)
   04612 Antigen processing and presentation
    414785 (RT1-M6-1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    414785 (RT1-M6-1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414785 (RT1-M6-1)
   05170 Human immunodeficiency virus 1 infection
    414785 (RT1-M6-1)
   05168 Herpes simplex virus 1 infection
    414785 (RT1-M6-1)
   05163 Human cytomegalovirus infection
    414785 (RT1-M6-1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    414785 (RT1-M6-1)
   05169 Epstein-Barr virus infection
    414785 (RT1-M6-1)
   05165 Human papillomavirus infection
    414785 (RT1-M6-1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    414785 (RT1-M6-1)
   05330 Allograft rejection
    414785 (RT1-M6-1)
   05332 Graft-versus-host disease
    414785 (RT1-M6-1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    414785 (RT1-M6-1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    414785 (RT1-M6-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    414785 (RT1-M6-1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    414785 (RT1-M6-1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414785 (RT1-M6-1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  414785 (RT1-M6-1)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 LapA_dom
Other DBs
NCBI-GeneID: 414785
NCBI-ProteinID: NP_001008852
RGD: 1598232
Ensembl: ENSRNOG00000022107
UniProt: Q6MFY2
Position
20
AA seq 330 aa
MGAPVLHATLLLLSAFLALTQTKNQSFAGSHFMQYLVTTTSSQPGLQDSHVCIVGHVDYM
PFMRFDSDGAAQRIQTRGPWMKQMGPEYLEMERKNAEGYSHRARENLRFAIQVYNQSDKA
HYSHAFDGQHYISLNSDLTTWSVGDSTAQITKRRWEADGVAEALSHFLKVSCVEHLQKHL
ETGKETLQRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVE
TRPAGDGTFQKWASVVVPNGEEQKYTCLVEHEGLPEPLTLRWKPATWPVVGITVGVVLLG
FVIIGALIAIVTMRKKRADPVDPVDLMDPV
NT seq 993 nt   +upstreamnt  +downstreamnt
atgggggctccagtgctgcatgctaccctactgctgctctcagccttcctggctctgacc
caaaccaagaaccagagttttgctggttcacacttcatgcagtatttggtaaccaccacc
tcgtctcaacccggtcttcaagattcgcatgtctgcattgttggccatgtggactacatg
ccatttatgcgctttgacagtgatggagctgctcagaggatccagacgagagggccttgg
atgaagcagatggggcctgagtatttggaaatggagagaaagaatgcggaggggtattca
cacagggctcgagaaaacctgcgattcgcaatccaagtctataaccagagcgataaagcg
cactatagccatgcttttgacggccaacattacatcagcctgaactcggacctgacaaca
tggagtgtgggagacagcacagctcagatcaccaagcgacggtgggaggcagatggtgta
gcagaggccttgagtcacttcttgaaagtctcttgtgttgaacacctgcagaagcacttg
gagacagggaaggagactctacagcgctcagatcccccaaaggcacatgtgacccttcac
cccagacctgaaggtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgac
atcaccctgacctggcagttgaatggggaggacctgacccaggacatggagcttgtggag
accaggcctgcaggggatggaaccttccagaagtgggcatctgtggtggtgcctaatggg
gaggagcagaagtacacatgccttgtggagcatgaggggctgcctgagcccctcacactg
agatggaaaccagcaacttggcctgtggttggaataactgttggtgtagttctccttggg
tttgtcatcattggagctctgattgccattgtgaccatgaggaagaagagagcagaccct
gtggatcctgtggaccttatggatccagtgtga

KEGG   Rattus norvegicus (rat): 414786
Entry
414786            CDS       T01003                                 

Gene name
RT1-M1-2
Definition
(RefSeq) RT1 class I, locus M1, gene 2 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    414786 (RT1-M1-2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414786 (RT1-M1-2)
   04145 Phagosome
    414786 (RT1-M1-2)
  09143 Cell growth and death
   04218 Cellular senescence
    414786 (RT1-M1-2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    414786 (RT1-M1-2)
   04612 Antigen processing and presentation
    414786 (RT1-M1-2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    414786 (RT1-M1-2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414786 (RT1-M1-2)
   05170 Human immunodeficiency virus 1 infection
    414786 (RT1-M1-2)
   05168 Herpes simplex virus 1 infection
    414786 (RT1-M1-2)
   05163 Human cytomegalovirus infection
    414786 (RT1-M1-2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    414786 (RT1-M1-2)
   05169 Epstein-Barr virus infection
    414786 (RT1-M1-2)
   05165 Human papillomavirus infection
    414786 (RT1-M1-2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    414786 (RT1-M1-2)
   05330 Allograft rejection
    414786 (RT1-M1-2)
   05332 Graft-versus-host disease
    414786 (RT1-M1-2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    414786 (RT1-M1-2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    414786 (RT1-M1-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    414786 (RT1-M1-2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    414786 (RT1-M1-2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414786 (RT1-M1-2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  414786 (RT1-M1-2)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 MHC_I_3 ig PTCRA Psg1
Other DBs
NCBI-GeneID: 414786
NCBI-ProteinID: NP_001008849
RGD: 1359434
UniProt: Q6MFZ3
Position
20
AA seq 341 aa
MKVLLVLAVLLLMVTLVITKNPKGSHSLRYLQTLLSWPGLAEPQFIFVGYVGNTQFIGFN
SRSQSQWSLHRAPWKDQQTPEYWEKTIQEVLSEKRNLKEVMEKMLHIYPNSTTGNHTIQM
RYGCDVLPGGYFSHGILELNFDSQDYIILNDELHNWIIDGKAAEMLKQEWEDTHYAQIVK
NYLKGSCVDELLTELDLGKDYLLRTDTPRTHVIHKVRPDRKIILRCWALNFYPAEITITW
QRDGRNQTQDVEVIETRPAGDGTFQKWAAVVVPSGEEQKYTCRVEHEGLPEPITLRWESP
QSTIPVMAIVLCLVLGALLTGAVVTSLIWKRKIKGKDRAGS
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaaggtccttttagttctggctgtcctgctgcttatggtcacccttgtcatcaccaag
aatccaaaaggttcacactctctgagatatttacaaacactcctgtcatggcctggcctt
gcggagccccagttcatctttgttggctatgtgggcaatacacagttcataggattcaac
agcagatcacagagtcagtggtcgttgcacagagcaccgtggaaagatcaacagactcca
gagtattgggagaagacaatacaggaagtcctgagtgaaaaacggaacttgaaagaagta
atggagaaaatgcttcacatctaccctaacagcacgactggtaatcacacaatccagatg
aggtatggctgtgacgtgctgcctggaggttacttcagtcatggaatcctagaattgaat
tttgatagccaggattacatcatactgaatgatgaactgcacaactggataatagatggc
aaggcagctgagatgctcaagcaggagtgggaggacacgcattatgcacaaattgtgaag
aattacctgaagggatcatgtgtggatgaactccttacagagctggaccttgggaaagat
tatttgctgagaacagacacccccagaacacacgtgatccacaaagtcagacctgacaga
aaaatcatcctgaggtgctgggccctgaacttctaccctgctgaaatcactataacctgg
cagagagatgggaggaaccagactcaggatgtggaagtgatagagacgaggcctgcaggg
gatggaaccttccagaagtgggcagctgtggtggtgccttctggggaagagcagaaatac
acatgccgtgtggagcatgaggggctgccagagcccatcaccctgagatgggagtctcct
cagtccaccatccccgtcatggctattgttctttgtctggttcttggagctctgcttaca
ggagcagtggtgacttctctgatatggaagaggaagattaaaggtaaagacagggcaggg
tcttag

KEGG   Rattus norvegicus (rat): 414787
Entry
414787            CDS       T01003                                 

Gene name
RT1-M10-1
Definition
(RefSeq) RT1 class I, locus M10, gene 1 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    414787 (RT1-M10-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414787 (RT1-M10-1)
   04145 Phagosome
    414787 (RT1-M10-1)
  09143 Cell growth and death
   04218 Cellular senescence
    414787 (RT1-M10-1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    414787 (RT1-M10-1)
   04612 Antigen processing and presentation
    414787 (RT1-M10-1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    414787 (RT1-M10-1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414787 (RT1-M10-1)
   05170 Human immunodeficiency virus 1 infection
    414787 (RT1-M10-1)
   05168 Herpes simplex virus 1 infection
    414787 (RT1-M10-1)
   05163 Human cytomegalovirus infection
    414787 (RT1-M10-1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    414787 (RT1-M10-1)
   05169 Epstein-Barr virus infection
    414787 (RT1-M10-1)
   05165 Human papillomavirus infection
    414787 (RT1-M10-1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    414787 (RT1-M10-1)
   05330 Allograft rejection
    414787 (RT1-M10-1)
   05332 Graft-versus-host disease
    414787 (RT1-M10-1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    414787 (RT1-M10-1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    414787 (RT1-M10-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    414787 (RT1-M10-1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    414787 (RT1-M10-1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414787 (RT1-M10-1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  414787 (RT1-M10-1)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 414787
NCBI-ProteinID: NP_001008851
RGD: 1359635
UniProt: Q6MFZ4
Position
20
AA seq 304 aa
MKNREPWVVVLLLLLVTMDLTQYCAGSRWLQTFNTVIAEPRKSAHQFIQVSYVDSIQFQG
FDSQAPNAKMRPRAAWMEQEPPEYWEKGTAQAPRLSLTNQRVLQFLVIENKHSKNEYHTL
QELFGCNVANDGSFLRGQYRLTYYGYDNIILNEDLSSWTTEGSAAQDLMKYSETGGMAEM
PPKTHLTHQVRPDGNVTLRCWALGFYPADITLTWQRDGKNHTQDMELPDTRPAGDGTFQK
WAVVIVPSGEEQRYTCHVHHEGLPEPLTLKWEPSTTIPIMAILTGLILGTLVMGTVVYLL
VWKK
NT seq 915 nt   +upstreamnt  +downstreamnt
atgaagaaccgtgaaccctgggttgtagtcctcctcctcctattggtgaccatggacctg
acccagtattgtgcaggttcacgctggctgcagactttcaacactgtgattgcggaacct
cgcaagtcagcgcaccagttcatccaggtcagctatgtagactcgatacagtttcaggga
ttcgacagccaagctcccaatgcaaagatgcgacctcgggctgcttggatggagcaggag
ccacctgaatactgggagaagggaacagcacaagccccgcgcttgtcactgacaaaccaa
cgagtccttcagttcctggtgattgagaataaacacagcaagaatgaatatcacaccctg
caggaattgtttggctgcaatgtagcaaatgatgggagcttcctccgcggtcaataccgg
ctcacctactatggctatgataacatcatcctgaatgaggacctgagctcttggaccaca
gagggatctgcagcacaagacctgatgaagtactcggagaccggaggcatggcagaaatg
ccccccaaaacacatctgacccaccaagtaagacctgatggcaatgtcaccctgaggtgc
tgggccttaggcttctacccagctgacatcaccctgacctggcagagggatggcaaaaac
cacacccaggacatggagctgccagacaccaggccagcaggggatggaaccttccagaaa
tgggcagtagtgatagttccttctggagaggagcagagatacacgtgtcatgtgcaccat
gaaggattacctgagcctctcactctgaagtgggagccttcaacaaccatccccatcatg
gcaattctcactggcctgattcttgggactttggtgatgggaactgtggtgtatcttctg
gtatggaagaaataa

KEGG   Rattus norvegicus (rat): 414788
Entry
414788            CDS       T01003                                 

Gene name
RT1-T24-3
Definition
(RefSeq) RT1 class I, locus T24, gene 3
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    414788 (RT1-T24-3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414788 (RT1-T24-3)
   04145 Phagosome
    414788 (RT1-T24-3)
  09143 Cell growth and death
   04218 Cellular senescence
    414788 (RT1-T24-3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    414788 (RT1-T24-3)
   04612 Antigen processing and presentation
    414788 (RT1-T24-3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    414788 (RT1-T24-3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414788 (RT1-T24-3)
   05170 Human immunodeficiency virus 1 infection
    414788 (RT1-T24-3)
   05168 Herpes simplex virus 1 infection
    414788 (RT1-T24-3)
   05163 Human cytomegalovirus infection
    414788 (RT1-T24-3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    414788 (RT1-T24-3)
   05169 Epstein-Barr virus infection
    414788 (RT1-T24-3)
   05165 Human papillomavirus infection
    414788 (RT1-T24-3)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    414788 (RT1-T24-3)
   05330 Allograft rejection
    414788 (RT1-T24-3)
   05332 Graft-versus-host disease
    414788 (RT1-T24-3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    414788 (RT1-T24-3)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    414788 (RT1-T24-3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    414788 (RT1-T24-3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    414788 (RT1-T24-3)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414788 (RT1-T24-3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  414788 (RT1-T24-3)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 C2-set_2
Other DBs
NCBI-GeneID: 414788
NCBI-ProteinID: NP_001159875
RGD: 1624211
Ensembl: ENSRNOG00000045924
Position
20
AA seq 334 aa
MWALIFWFLTHPQETGARSHSLHYSYSAVTEPGPGVPAFFASGFVDNQPFIHYDSRKMEA
EPCADWLRENPYYFDEETQVFTNRMKIFQLSLRNIQQYYNSSGDRSQRADGFHQQAGPHT
LQFTYGCEMQDNRTTGHWQYGYDGRDYLTLDLDSMQYTAATFIAGYTKHKWQNNEYWLER
EKTYLEKECVLWLKRYLTMGGENFTRTDPPQTTVTCHPRPEGDVTLRCWALGFYPADITL
TWQLNGEDLTQDMELVETRPAGDGTFQKWASVVVPLGKEQKYTCRVEHEGLPEPVSLTWE
PLQLTTSKTEVCARGRWGLQATTLCVLMVFWAWC
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtgggctctgatcttctggttcctgacccacccccaagaaactggagcccgatcacac
tctctgcactattcttactcagccgtgacagagccgggcccaggagttcctgcatttttt
gccagtggttttgtagataaccagcccttcatccactatgacagtaggaagatggaggca
gaaccttgtgctgactggctgagggaaaatccatattactttgatgaggagacccaggtt
ttcaccaatcggatgaagatcttccagttgagcctgagaaacattcagcaatactacaac
agctctggtgaccggagtcagagagcagacggcttccaccagcaagcaggccctcacacc
ctccagttcacgtacggctgtgagatgcaggacaacaggaccacagggcactggcagtat
ggctacgatggcagggattacctgaccttggacttggactctatgcaatatacagcagcc
accttcattgctggctacaccaagcacaagtggcaaaacaatgagtactggctggagaga
gagaagacctacttggagaaggagtgtgtcctgtggctaaagagatacttaactatggga
ggagagaactttacccgaactgaccctccacagacaaccgtgacatgccaccccagacct
gaaggtgatgtgaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctg
acctggcagttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcct
gcaggggatggaaccttccagaagtgggcatctgtggtggtacctcttgggaaggagcag
aagtacacatgccgtgtagagcatgagggactgcctgagcccgtcagcctgacatgggag
cctcttcagctcaccacgtccaagacagaagtatgtgctaggggcagatggggacttcaa
gcaaccaccctgtgtgtcctcatggttttctgggcctggtgctag

KEGG   Rattus norvegicus (rat): 414789
Entry
414789            CDS       T01003                                 

Gene name
RT1-CE15
Definition
(RefSeq) RT1 class I, locus CE15 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    414789 (RT1-CE15)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414789 (RT1-CE15)
   04145 Phagosome
    414789 (RT1-CE15)
  09143 Cell growth and death
   04218 Cellular senescence
    414789 (RT1-CE15)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    414789 (RT1-CE15)
   04612 Antigen processing and presentation
    414789 (RT1-CE15)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    414789 (RT1-CE15)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414789 (RT1-CE15)
   05170 Human immunodeficiency virus 1 infection
    414789 (RT1-CE15)
   05168 Herpes simplex virus 1 infection
    414789 (RT1-CE15)
   05163 Human cytomegalovirus infection
    414789 (RT1-CE15)
   05167 Kaposi sarcoma-associated herpesvirus infection
    414789 (RT1-CE15)
   05169 Epstein-Barr virus infection
    414789 (RT1-CE15)
   05165 Human papillomavirus infection
    414789 (RT1-CE15)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    414789 (RT1-CE15)
   05330 Allograft rejection
    414789 (RT1-CE15)
   05332 Graft-versus-host disease
    414789 (RT1-CE15)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    414789 (RT1-CE15)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    414789 (RT1-CE15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    414789 (RT1-CE15)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    414789 (RT1-CE15)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414789 (RT1-CE15)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  414789 (RT1-CE15)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 414789
NCBI-ProteinID: NP_001008838
RGD: 1359630
UniProt: Q6MG29
Position
20
AA seq 373 aa
MGAMARRTLLLLLAAALAPTQTLPSSHSMRCFKTAVSRPGLGEPRFIAVAYVDDTEFVRY
DGDAENPRTEPRARWMEREGPEYWEEETRKIKGQEQWFRMSLRILRGYYNQSEGGSHTFQ
KMSGCDVGSDGSLLRGYNQYAYDGHDYIALNKDLKTWTAADFAALITKTKWDQAGTAERK
RAYLEGTCVEWLRRYLELGKETLLRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLT
WQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCLVEHEGLPEPLTLRWEA
PPGTDSNMETKVIYVVLGAVAMIGAVAVIGAVVAVVRRRRRKRNTGGTGGDYAPAPGSDS
CQSSDVSLADCEA
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgggggcgatggcccggcgcacgctgctcctgctgctagcggccgccctggccccgacc
cagaccctcccgagctcacattcgatgcggtgtttcaaaaccgccgtgtcccggccgggc
ctcggggagccccggttcatagctgtcgcctacgtggacgacacggagttcgtgcgctac
gacggcgacgcggagaatccgaggaccgagccgcgggcgcggtggatggagcgggagggg
ccggagtactgggaggaggagacacggaaaatcaagggacaggagcagtggttccgaatg
agcctgaggatcttgcgcggctactacaaccagagcgagggcggatcgcacaccttccag
aagatgtccggctgtgacgtggggtcagacgggagcctcctccgcgggtataatcagtac
gcctacgacggccacgattacatcgccctgaacaaagacctgaagacctggacagcggcg
gactttgcagcactgatcaccaaaaccaagtgggatcaggctggtactgcagagagaaag
agggcctacctggagggcacgtgcgtggagtggctccgcagatacctggagctcgggaag
gagacgctgctgcgctcagatcccccaaaggcacatgtgacccttcaccccagacctgaa
ggtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggtgcctcttgggaaggagcagaat
tacacatgccttgtggagcatgaggggctgcctgagcctctcaccctgagatgggaggct
cctccaggcactgactccaacatggaaaccaaagttatttatgttgtccttggagctgtg
gccatgattggagctgtggccgtgattggagctgtggtggctgttgtgaggaggaggagg
aggaagagaaacacaggtggaacaggaggagactacgcccctgctccaggcagtgacagc
tgccagagctctgatgtgtccctcgcagattgtgaagcatga

KEGG   Rattus norvegicus (rat): 414790
Entry
414790            CDS       T01003                                 

Gene name
RT1-CE13
Definition
(RefSeq) RT1 class I, locus CE13 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    414790 (RT1-CE13)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414790 (RT1-CE13)
   04145 Phagosome
    414790 (RT1-CE13)
  09143 Cell growth and death
   04218 Cellular senescence
    414790 (RT1-CE13)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    414790 (RT1-CE13)
   04612 Antigen processing and presentation
    414790 (RT1-CE13)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    414790 (RT1-CE13)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414790 (RT1-CE13)
   05170 Human immunodeficiency virus 1 infection
    414790 (RT1-CE13)
   05168 Herpes simplex virus 1 infection
    414790 (RT1-CE13)
   05163 Human cytomegalovirus infection
    414790 (RT1-CE13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    414790 (RT1-CE13)
   05169 Epstein-Barr virus infection
    414790 (RT1-CE13)
   05165 Human papillomavirus infection
    414790 (RT1-CE13)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    414790 (RT1-CE13)
   05330 Allograft rejection
    414790 (RT1-CE13)
   05332 Graft-versus-host disease
    414790 (RT1-CE13)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    414790 (RT1-CE13)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    414790 (RT1-CE13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    414790 (RT1-CE13)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    414790 (RT1-CE13)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414790 (RT1-CE13)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  414790 (RT1-CE13)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C ig C2-set_2
Other DBs
NCBI-GeneID: 414790
NCBI-ProteinID: NP_001008836
RGD: 1359196
UniProt: Q6MG31
Position
20
AA seq 365 aa
MGAMAPRMLLLLLAAALAPTQTRAGSHSLLYFYTAMSRPGLGEPWFMEVGYVDDTEFVRF
DNDAENPRMEPRARWMEREGPEYWERNTRIAKENEQWSRMGLRNLRGYYNQSEGGSHTVQ
RLYGCDVGSDGSLLRGYDQFAYDGRDYISLNEDLKTWAAADLAAQKTRNKWDQAGTAERR
RAYLEGTCLEWLRRYLELGKETLLRSDPPEAHVTLHPRPEGGVTLRCWALGFYPPGISLI
WQLNGEDLTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCHVEHEGLPEPLTLRWEP
PSSTDFNMRIIAVLVVLGAVAIIGAVVAVMMKWRRNTGGTGGDYTPAPGKASPNSCDLSL
PLCKA
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgggggcgatggcaccgcgcatgctactcctgctgctggcggccgccctggccccgacc
cagacccgcgcgggctcacactcgctgctgtatttctacaccgccatgtcccggcccggc
ctcggggagccctggttcatggaagtcggctacgtggacgacacggagttcgtgcgcttc
gacaacgacgcggagaatccgaggatggagccgcgggcgcggtggatggagcgggagggg
ccggagtattgggagaggaacacacggatcgccaaggaaaacgagcagtggtcccgaatg
ggcctgaggaacctgcgcggctactacaaccagagcgagggcggctctcacaccgtccag
agattgtatggttgtgacgtggggtcggacgggagcctcctccgcgggtatgatcagttc
gcctacgatggccgcgattacatctccctgaatgaagacctgaaaacgtgggcggcggca
gacctggcagcacagaagacccggaacaagtgggatcaggctggtactgcagagagacgc
agggcctacctggagggcacgtgcttggagtggctccgcagatacctggagctcgggaag
gagacgctgctgcgctcagatcccccagaggcacatgtgacccttcacccaagacctgaa
ggtggtgtcaccctgaggtgctgggccctgggcttctaccctcctggtatctccttgatc
tggcagttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtgcctcttgggaaggaacagaat
tacacatgccatgtagagcatgaggggctgcctgagcctctcaccctgagatgggagcct
ccttcatccacagacttcaacatgagaatcattgctgttctggttgtccttggagctgtg
gccatcattggagctgtggtggctgttatgatgaagtggaggagaaacacaggaggaaca
ggaggagactacacccctgctccaggtaaggccagccccaacagctgtgatttgtctctc
ccactttgtaaagcatga

KEGG   Rattus norvegicus (rat): 414791
Entry
414791            CDS       T01003                                 

Gene name
RT1-CE11
Definition
(RefSeq) RT1 class I, locus CE11 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    414791 (RT1-CE11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414791 (RT1-CE11)
   04145 Phagosome
    414791 (RT1-CE11)
  09143 Cell growth and death
   04218 Cellular senescence
    414791 (RT1-CE11)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    414791 (RT1-CE11)
   04612 Antigen processing and presentation
    414791 (RT1-CE11)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    414791 (RT1-CE11)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414791 (RT1-CE11)
   05170 Human immunodeficiency virus 1 infection
    414791 (RT1-CE11)
   05168 Herpes simplex virus 1 infection
    414791 (RT1-CE11)
   05163 Human cytomegalovirus infection
    414791 (RT1-CE11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    414791 (RT1-CE11)
   05169 Epstein-Barr virus infection
    414791 (RT1-CE11)
   05165 Human papillomavirus infection
    414791 (RT1-CE11)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    414791 (RT1-CE11)
   05330 Allograft rejection
    414791 (RT1-CE11)
   05332 Graft-versus-host disease
    414791 (RT1-CE11)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    414791 (RT1-CE11)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    414791 (RT1-CE11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    414791 (RT1-CE11)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    414791 (RT1-CE11)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414791 (RT1-CE11)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  414791 (RT1-CE11)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig MHC_I_C DUF2755 C2-set_2 Psg1 Marek_A Ig_2 Insulin_TMD
Other DBs
NCBI-GeneID: 414791
NCBI-ProteinID: NP_001008834
RGD: 1359483
UniProt: Q6MG33
Position
20
AA seq 367 aa
MGSRAPHTLLLLLVAALAQTQPRAGSHSLWYFTSALSWPGLGEPRFISVRYVDDTEFVRF
DSGSENPRYEPRAPWMEREGPEYWEQQTRRAKGNQQTFQVNLRTALRYYNQSEDRSHTIQ
RMYGCDMGSDRSLLRGYEQYAYDGRDYIALNEDLKTWTAADVAAQITRNKWDQAGVAERR
RAYLEGTCVKWLRRYLEHGKETLLRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLT
WQLNGEDLTQDMELVETRPAGDGTFQKWASVVVALGKEQKYTCLVEHEGLPEPLTQRWEA
PPSTDSNMETNVIYVVVGALVITGAVIIGAVVAVVRKRNTGGTGGDYAPAPGKANPNSSV
SLPDCKA
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggggtcaagggcacctcacactctgctcctgctgctggtggccgccctggcccagacc
cagccccgcgcgggctcgcactcgctgtggtatttcacctcggcgctgtcctggcccggc
ctcggggagccccggttcatctctgtccgctatgtggacgacacggagttcgtgcgcttc
gacagcggctctgagaatccgagatacgagccgcgggcgccgtggatggagcgggagggg
ccggagtattgggagcagcagacacggagagccaagggcaaccagcagactttccaagtg
aacctgaggaccgcgctccgctactacaaccagagcgaggaccgctctcacaccatccag
aggatgtatggctgtgacatggggtcggacaggagcctcctccgcgggtatgagcagtac
gcctacgacggccgcgattatatcgccctgaacgaagacctgaagacctggacagcagca
gacgtggctgcgcagatcacccggaacaagtgggatcaggctggtgttgcagagagacgc
agggcctacctggagggcacgtgcgtgaagtggctccgcagatacctggagcacgggaag
gagacgctgctgcgctcagatcccccaaaggcacatgtgacacttcaccccagacctgaa
ggtgatgtgaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtggctcttgggaaggagcagaag
tacacatgccttgtggagcatgaggggctgcctgagccgcttacccagagatgggaggct
cctccatccactgactccaacatggaaaccaatgtcatttatgttgtcgttggagccctg
gtcatcactggagctgtgatcattggagctgtggtggctgttgtgaggaagagaaacaca
ggaggaacaggaggagactacgcccctgctccaggcaaggccaaccccaacagctctgtg
tctctcccagattgtaaagcatga

KEGG   Rattus norvegicus (rat): 414792
Entry
414792            CDS       T01003                                 

Gene name
RT1-CE10
Definition
(RefSeq) RT1 class I, locus CE10 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    414792 (RT1-CE10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414792 (RT1-CE10)
   04145 Phagosome
    414792 (RT1-CE10)
  09143 Cell growth and death
   04218 Cellular senescence
    414792 (RT1-CE10)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    414792 (RT1-CE10)
   04612 Antigen processing and presentation
    414792 (RT1-CE10)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    414792 (RT1-CE10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414792 (RT1-CE10)
   05170 Human immunodeficiency virus 1 infection
    414792 (RT1-CE10)
   05168 Herpes simplex virus 1 infection
    414792 (RT1-CE10)
   05163 Human cytomegalovirus infection
    414792 (RT1-CE10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    414792 (RT1-CE10)
   05169 Epstein-Barr virus infection
    414792 (RT1-CE10)
   05165 Human papillomavirus infection
    414792 (RT1-CE10)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    414792 (RT1-CE10)
   05330 Allograft rejection
    414792 (RT1-CE10)
   05332 Graft-versus-host disease
    414792 (RT1-CE10)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    414792 (RT1-CE10)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    414792 (RT1-CE10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    414792 (RT1-CE10)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    414792 (RT1-CE10)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414792 (RT1-CE10)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  414792 (RT1-CE10)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig MHC_I_C C2-set_2 Ig_2 DUF2755
Other DBs
NCBI-GeneID: 414792
NCBI-ProteinID: NP_001008833
RGD: 1359292
Ensembl: ENSRNOG00000050210
UniProt: Q6MG34
Position
20
AA seq 360 aa
MEAMARPTLLLLLAAALAPTKTRAGSHWMRYFHTAVSRPGLGEPRYISVGYVDDTQFVRF
DSDAENPRYEPRARWMEREGPEYWERNTRIVKGKEQIFRDNLRTLLGYYNQSEGGSHTLQ
LMYGCDVGSDWSLLRGYEQHAYDGRDYIALNEDLKTWAAADFEAQKTRSKWEREGVAERS
RAYLEGECVKWLRRHLEHGKEALLRLDPPEAHVTLHPRPEGDVTLRCWALGFYPADITLT
WQLNGEDLTQDMEFVETRPAGDGTFQKWASVVVPLGKEQNYTCLVEHEGLPEPLTQRWEP
SPSTNTNMGIDVTSVFLGPLAVFVVLAIIGAAVAVVRRRRRRNTGGEGGDYTPAPGRDSS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggaggcgatggcacggcccacgctgctcctgctgctggccgccgccctggccccgacc
aagacccgcgcgggctcacactggatgcggtatttccacaccgccgtgtcccggccgggc
ctcggggagccccggtacatctctgtcggctacgtggacgacacgcagttcgtgcgcttc
gacagcgacgcggagaatccaagatacgagccgcgggcgcggtggatggaacgggagggg
ccggagtattgggagcggaacacacggatcgtcaagggaaaggagcagattttccgagac
aacctgaggaccctgcttggctactacaaccagagcgagggcggctctcacacactccag
ttgatgtatggctgtgacgtggggtcggactggagcctcctccgcgggtatgagcagcac
gcctacgacggccgcgattacatcgccctgaacgaagacctgaaaacgtgggcggcggcg
gactttgaggcacagaagacccggagcaagtgggagagggaaggtgttgcagagagaagc
agggcctacctggagggcgagtgtgtgaagtggctcaggagacacctggagcacgggaag
gaggcgctgctgcgcttagatcccccagaggcacatgtgacccttcaccccagacctgaa
ggtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcacattgacc
tggcagttgaatggggaggacctaacccaggacatggagtttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtggtggtgcctcttgggaaggagcagaat
tacacatgccttgtggagcatgaggggctgcctgagcctcttacccagagatgggagcct
tctccatccaccaacaccaacatgggaatcgatgttacttctgtttttcttggacctttg
gctgtctttgtagttttggccatcattggagctgcggtggctgttgtgaggaggaggagg
aggagaaacacaggtggggaaggaggagactacacccctgctccaggcagggacagctcc
tag

KEGG   Rattus norvegicus (rat): 414793
Entry
414793            CDS       T01003                                 

Gene name
RT1-CE3
Definition
(RefSeq) RT1 class I, locus CE3 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    414793 (RT1-CE3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414793 (RT1-CE3)
   04145 Phagosome
    414793 (RT1-CE3)
  09143 Cell growth and death
   04218 Cellular senescence
    414793 (RT1-CE3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    414793 (RT1-CE3)
   04612 Antigen processing and presentation
    414793 (RT1-CE3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    414793 (RT1-CE3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414793 (RT1-CE3)
   05170 Human immunodeficiency virus 1 infection
    414793 (RT1-CE3)
   05168 Herpes simplex virus 1 infection
    414793 (RT1-CE3)
   05163 Human cytomegalovirus infection
    414793 (RT1-CE3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    414793 (RT1-CE3)
   05169 Epstein-Barr virus infection
    414793 (RT1-CE3)
   05165 Human papillomavirus infection
    414793 (RT1-CE3)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    414793 (RT1-CE3)
   05330 Allograft rejection
    414793 (RT1-CE3)
   05332 Graft-versus-host disease
    414793 (RT1-CE3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    414793 (RT1-CE3)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    414793 (RT1-CE3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    414793 (RT1-CE3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    414793 (RT1-CE3)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414793 (RT1-CE3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  414793 (RT1-CE3)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2 DUF5362 Gram_pos_anchor
Other DBs
NCBI-GeneID: 414793
NCBI-ProteinID: NP_001008841
RGD: 1598231
Ensembl: ENSRNOG00000031607
UniProt: Q6MG38
Position
20
AA seq 352 aa
MEVMAPRALLLLLAAALALAQTGIGSHSLRYFETALSRPGFGESRFIIVGYVDDTQFMRF
DSDAENPRMEPRARWMEREGPGYWEQNTRMAKRQEQWYRVNLRTALRYYNQSEGGSHTFQ
RMYGCDVGSDGSLLRGYNQFAYDSLDYIALNEDLKTWTAADTTGRMTQSKWVQAGVADYY
RAYLEGECVEWLRRYLELGKETLMRSDPPKAHVTLHPRPEGDVTLRCWALGFYPADITLT
WQLNGEDLTQDMELVETRPAGDGTFQKWASVVVPPGKEQNYTCLVEHEGLPEPLTLRWAP
SLSTDSNMETTVIYVVLGAISALAIIGALVPVVRRRKRNTGGKGGVYAPAPG
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggaggtgatggcaccgcgggcgctgctcctgctgctggcggccgccctggccctggcc
cagaccggcataggctcacactcgctgcggtatttcgaaaccgccttgtcccggcccggc
ttcggggagtcccggttcattatcgtcggctacgtggacgacacgcagttcatgcgcttc
gacagcgacgcggagaatccgaggatggagccgcgggcgcggtggatggagcgggagggg
ccggggtattgggagcagaacacacggatggcgaagagacaagagcaatggtaccgagtg
aacctgaggaccgcgctccgctactacaaccagagcgagggcggctcgcacaccttccag
aggatgtacggctgtgacgtggggtcggacggaagcctcctccgcggatataatcagttc
gcctacgacagcctcgattacatcgccctgaacgaagacctgaagacctggacagcggcg
gacacaacaggacggatgacacagagcaagtgggttcaggctggtgttgcagactattac
agagcctacctggagggcgagtgcgtggagtggctccgcagatacctggaactcgggaag
gagacgctgatgcgctcagatcccccaaaggcacatgtgacccttcaccccagacctgaa
ggtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcatctgtagtggtgcctcctgggaaggagcagaat
tacacatgccttgtggaacatgaggggctgcctgagcccctcaccttgagatgggcgcct
tctctatccactgactccaacatggaaaccactgtcatttatgtcgtccttggagccatc
tctgctctggccattattggagctctggtgcctgttgtgaggaggaggaagagaaacaca
ggtggaaaaggaggagtctacgcccctgctccaggttag

KEGG   Rattus norvegicus (rat): 414819
Entry
414819            CDS       T01003                                 

Gene name
RT1-CE16
Definition
(RefSeq) RT1 class I, locus CE16 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    414819 (RT1-CE16)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414819 (RT1-CE16)
   04145 Phagosome
    414819 (RT1-CE16)
  09143 Cell growth and death
   04218 Cellular senescence
    414819 (RT1-CE16)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    414819 (RT1-CE16)
   04612 Antigen processing and presentation
    414819 (RT1-CE16)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    414819 (RT1-CE16)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    414819 (RT1-CE16)
   05170 Human immunodeficiency virus 1 infection
    414819 (RT1-CE16)
   05168 Herpes simplex virus 1 infection
    414819 (RT1-CE16)
   05163 Human cytomegalovirus infection
    414819 (RT1-CE16)
   05167 Kaposi sarcoma-associated herpesvirus infection
    414819 (RT1-CE16)
   05169 Epstein-Barr virus infection
    414819 (RT1-CE16)
   05165 Human papillomavirus infection
    414819 (RT1-CE16)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    414819 (RT1-CE16)
   05330 Allograft rejection
    414819 (RT1-CE16)
   05332 Graft-versus-host disease
    414819 (RT1-CE16)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    414819 (RT1-CE16)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    414819 (RT1-CE16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    414819 (RT1-CE16)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    414819 (RT1-CE16)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   414819 (RT1-CE16)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  414819 (RT1-CE16)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C ig Psg1 C2-set_2 PRD1_DD DAG1 Ig_2 TMEM154 Herpes_gE Protocadherin
Other DBs
NCBI-GeneID: 414819
NCBI-ProteinID: NP_001008839
RGD: 1359403
UniProt: Q6MG28
Position
20
AA seq 370 aa
MGAMAPRTLLLLLAAALAPTQTRAGSHSLRYFVTAISGPGLGEPRFMEVGYVDGTEFVRY
DSDAKNPGMEPRARWMEREGREYWERETRRVKENEQLFRGNLRTLLGYYNQSEGGSHTIQ
WMSGCDVGSDGSLLRGYDQFAYDGRDYIVLNEDLKTWTAADTAARITRNKWDRAGVAERH
KAYLEGKCLESLLRYLELGKETLLRSDPPKAHVTLHPRPEGDVTLRCWALGFYPAGISLT
WQLNGEDLTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCLVEHEGLPEPLTQRWEP
SPSTDSNMETYVIYVILGAVAIIAAVIIVAVVAVVMKRRRNTGGKVGVYAPAPSRDSSES
SDVSLSDCKA
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgggggcgatggcaccgcgcacgctgctcctgctgctggcggccgccctggccccgacg
cagactcgcgcgggctcacactcgctgcggtatttcgtcaccgccatatccgggcccggc
ctcggggagccccgattcatggaagtcggctacgtggacggcacggagttcgtgcgctac
gacagcgacgcaaagaatccggggatggagccgcgggcgaggtggatggagcgggagggg
cgggagtattgggagcgggagacacggagagtcaaggaaaacgagcagttgttccgaggg
aacctgaggaccctgcttggctactacaaccagagcgagggcggctctcacaccatccag
tggatgtctggctgtgacgtggggtcggacgggagcctcctccgcgggtatgatcagttc
gcctacgacggccgcgattacatcgtcctgaacgaagacctgaaaacgtggacggcggcg
gacacggcggcacggatcacccggaacaagtgggatcgggctggtgttgcagagagacac
aaggcctacctggagggcaagtgcttggagtcgctcctcagatacctggagctcgggaag
gagacgctgctgcgctcagatcccccaaaggcacatgtgacccttcaccccagacctgaa
ggtgatgtcaccctgaggtgctgggccctgggcttctaccctgctggcatctccctgacc
tggcagttgaatggggaggacctgacccaggacatggagcttgtggagaccaggcctgca
ggggatggaaccttccaaaagtgggcatctgtggtggtgcctcttgggaaggagcagaat
tacacatgccttgtggagcatgaggggctgcctgagccgcttacccagagatgggagcct
tctccatcgaccgactccaacatggaaacctatgtcatttatgtcatccttggagctgtg
gccatcattgcagctgtgatcattgtagctgtggtggctgttgtgatgaagaggaggaga
aacacaggtggaaaagtaggagtctacgcccctgctccaagcagggacagctctgagagc
tctgatgtgtctctctcagattgtaaagcatga

KEGG   Rattus norvegicus (rat): 499400
Entry
499400            CDS       T01003                                 

Gene name
RT1-M5
Definition
(RefSeq) RT1 class Ib, locus M5 isoform 2 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    499400 (RT1-M5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    499400 (RT1-M5)
   04145 Phagosome
    499400 (RT1-M5)
  09143 Cell growth and death
   04218 Cellular senescence
    499400 (RT1-M5)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    499400 (RT1-M5)
   04612 Antigen processing and presentation
    499400 (RT1-M5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    499400 (RT1-M5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    499400 (RT1-M5)
   05170 Human immunodeficiency virus 1 infection
    499400 (RT1-M5)
   05168 Herpes simplex virus 1 infection
    499400 (RT1-M5)
   05163 Human cytomegalovirus infection
    499400 (RT1-M5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    499400 (RT1-M5)
   05169 Epstein-Barr virus infection
    499400 (RT1-M5)
   05165 Human papillomavirus infection
    499400 (RT1-M5)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    499400 (RT1-M5)
   05330 Allograft rejection
    499400 (RT1-M5)
   05332 Graft-versus-host disease
    499400 (RT1-M5)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    499400 (RT1-M5)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    499400 (RT1-M5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    499400 (RT1-M5)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    499400 (RT1-M5)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   499400 (RT1-M5)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  499400 (RT1-M5)
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 ig MHC_I_3
Other DBs
NCBI-GeneID: 499400
NCBI-ProteinID: NP_001041510
RGD: 1595816
Ensembl: ENSRNOG00000033136
Vega: OTTRNOG00000001465
Position
20
AA seq 348 aa
MGSSVFSVLLPLLLSRAWALNQVGAGIHSLQFFATAVTQPSSREHSFIFVGFVDDTQFLC
YNNQGESQRMEPRALWVKNMGPGYWERQTRMVKDISKNSLVNLREAMSVYNHSEDGTHVF
QCVSGCDVGPDGLFLRGHEQHAYDGRDYLALNKDLHSWTAGDTAAQITRRKWEEAGVAEQ
RRTYLKGECVESLRTYLEIGKETLLGADPPKAHVTHHPSPEGDNTLRCWALGFYPSDITL
TWQRDGEDLTQDMELVETRPGGDGTFQKWAAVVVPSGEEHRYTCCVEHEGLTEPLLLKWD
PSKHTIPIMGITAGLVFLGVAFTGAVVAIAMRKQRAHLERSDKYLTWT
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgggaagctccgttttctctgtcctcctaccattgctgctcagccgagcttgggcattg
aaccaggtcggcgcaggcatccattccttgcagttttttgccactgctgtgacccagcct
agttcgagggagcattccttcatctttgtcggctttgtggacgacacacagttcctgtgc
tacaacaatcagggggaaagtcagagaatggagccgcgcgctctgtgggtaaagaatatg
gggcccggatattgggagcggcagactaggatggtcaaggacatttccaagaattcccta
gtgaacttgcgggaggccatgagtgtctacaaccacagcgaggatggcactcatgtcttt
cagtgtgtgtctggctgtgacgtggggccagatggactcttcctccgtgggcacgagcag
cacgcatacgacggccgcgactacctcgctctaaacaaggacctgcactcctggacggca
ggtgacacagcagcgcagatcacgcggcgcaagtgggaggaagctggtgtcgcggagcaa
aggcgaacctacctgaagggcgagtgtgtggagtcgctccgcacatacctggagataggg
aaggagactctgctaggagcagatcctccaaaagcacatgtgacccatcaccccagccct
gaaggtgataacaccctgaggtgctgggccctgggcttctacccttctgacatcaccctg
acctggcagcgggatggagaagacctgacccaggacatggagcttgtggagacaagacct
gggggtgatggaaccttccagaagtgggcagctgtggtggtgccttctggggaggagcat
agatacacatgctgtgtggagcatgaggggctaactgagcctctccttctgaaatgggac
ccttctaagcacaccatccccatcatgggaatcactgctggcctggttttccttggagtt
gccttcactggagctgtggttgccatagcgatgaggaagcagagagcacatttggaaaga
agtgacaaatacctcacatggacatga

KEGG   Rattus norvegicus (rat): 680842
Entry
680842            CDS       T01003                                 

Gene name
RT1-M1-5
Definition
(RefSeq) RT1 class I, M1, gene 5 precursor
  KO
K06751  MHC class I antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04145  Phagosome
rno04218  Cellular senescence
rno04514  Cell adhesion molecules
rno04612  Antigen processing and presentation
rno04940  Type I diabetes mellitus
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05203  Viral carcinogenesis
rno05320  Autoimmune thyroid disease
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    680842 (RT1-M1-5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    680842 (RT1-M1-5)
   04145 Phagosome
    680842 (RT1-M1-5)
  09143 Cell growth and death
   04218 Cellular senescence
    680842 (RT1-M1-5)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    680842 (RT1-M1-5)
   04612 Antigen processing and presentation
    680842 (RT1-M1-5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    680842 (RT1-M1-5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    680842 (RT1-M1-5)
   05170 Human immunodeficiency virus 1 infection
    680842 (RT1-M1-5)
   05168 Herpes simplex virus 1 infection
    680842 (RT1-M1-5)
   05163 Human cytomegalovirus infection
    680842 (RT1-M1-5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    680842 (RT1-M1-5)
   05169 Epstein-Barr virus infection
    680842 (RT1-M1-5)
   05165 Human papillomavirus infection
    680842 (RT1-M1-5)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    680842 (RT1-M1-5)
   05330 Allograft rejection
    680842 (RT1-M1-5)
   05332 Graft-versus-host disease
    680842 (RT1-M1-5)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    680842 (RT1-M1-5)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    680842 (RT1-M1-5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    680842 (RT1-M1-5)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    680842 (RT1-M1-5)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   680842 (RT1-M1-5)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  680842 (RT1-M1-5)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Psg1 YtzH DUF6133 LapA_dom Ig_2
Other DBs
NCBI-GeneID: 680842
NCBI-ProteinID: NP_001161804
RGD: 1587041
Position
20
AA seq 354 aa
MKTFVHQALLLLLIVTLAITGHPKGLHSLNYKQTLLEWPGFLELQFIAVIYADDIQFLGL
NSIWGSSRAENKVPWMDEDEPETSEKVTQSMLDEKDLLTKIMKKVLHIYNYSMTGYHTIQ
RRRGCYVVPGGHFSHGFVELTFNNHDYIMLNEDLETWSVVGKAAEMIRQDFEEENFAKYM
REYLRGPCVEGILGLLQYGEKALLRAGTPKTHVTHKVTADGKITLRCWALNFYPAEITLI
WQKDGSNKTQDVEVIETRPSGDGNFQKWAAVVVPSGEEQRFTCHVEHERLPKPITLRWES
PQSINSTMAIAIAVVLGALLMGAVLTFFIWKRRTKGKEKQSLSSWLHGNIKPNL
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaaaacctttgtacaccaggctctcctcctgctgctcatcgtcactctggctatcaca
gggcatccaaagggtttacactctctgaattataaacaaactctcctggaatggcctggc
tttttggaactacagtttatcgctgttatctatgcggatgatatacagttcctaggactc
aacagcatatgggggagttcgagggcagagaacaaagtaccatggatggatgaggatgaa
ccagagacttcagagaaagtaacacagagcatgctggatgaaaaagatctcttgacaaaa
ataatgaagaaagtgctccacatatacaattacagcatgactggttatcacacaatccag
aggaggcgtggctgttatgtggtgccaggagggcacttcagtcacggattcgtagaatta
accttcaataaccacgattatatcatgctgaatgaggacctggaaacctggagcgtggtt
ggcaaggccgctgagatgatcaggcaagactttgaggaggaaaattttgcaaaatacatg
agagaatacctgcggggtccatgtgtggaagggatccttggactcctgcaatatggtgag
aaggccttgctgagagcaggcactcctaaaacacatgtgacccataaggtcacagctgat
gggaaaataaccttgaggtgctgggctttgaacttctaccctgctgaaatcaccttgatc
tggcagaaggatgggagcaacaagacccaggatgtggaggtgatagagaccaggccttca
ggggatggaaacttccagaagtgggcagctgtggtggtgccatctggggaagagcagaga
ttcacatgtcatgtggagcatgagcgtctgcctaagcccatcaccctgagatgggagtct
cctcagtccatcaactctaccatggctattgctattgctgtggttcttggagctctgctt
atgggagcagtgttgactttttttatatggaagaggaggactaaaggtaaggaaaagcag
agtctgagttcatggcttcatggaaatatcaagcctaatctgtaa

DBGET integrated database retrieval system