KEGG   Rattus norvegicus (rat): 102548286Help
Entry
102548286         CDS       T01003                                 

Definition
(RefSeq) peroxisomal biogenesis factor 19-like
  KO
K13337  peroxin-19
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102548286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pex19 Rod-binding HHH_4 GAS
Motif
Other DBs
NCBI-GeneID: 102548286
NCBI-ProteinID: XP_017443382
RGD: 7538513
UniProt: G3V907
Position
18q12.2
AA seq 299 aa AA seqDB search
MAAAEGGCGAGVEADRELEELLESALDDFDKAKPSPAPSPTISAPDASGPQKRSPGDTAK
DALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDAS
SQQEFTSCLKETLSGLAKNATDLQNAGMSEEELTKAMEGLGMDEGDGEGNILPIMQSLMQ
NLLSKDVLYPSLKEITEKYPEWLQSHQESIPPEQFEKYQQQHSVMGKICEQFEAETPTDS
EATHRARFEAVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGANGEQCLIM
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgctgaaggaggttgcggtgctggagtcgaagcggaccgggaattggaggag
cttttagaaagtgctcttgatgattttgataaagccaaaccctccccagcaccctctcct
accatctcggcccccgatgcttcagggccccagaagagatcgccaggagacactgccaaa
gatgctctctttgcctcccaagagaaatttttccaggaactgttcgacagtgagctggct
tcccaagccaccgcagagtttgagaaggcaatgaaggagctggctgaggaagagccccat
ctggtggagcagttccagaagctctcagaggcagctgggagagtgggcagcgatgcaagt
tctcaacaagaatttacttcttgcctaaaggagacattaagtgggctagccaaaaatgcc
actgaccttcagaacgcaggcatgtctgaagaagaactgacgaaagccatggaagggctg
ggcatggatgaaggagacggggaagggaacattctccccatcatgcagagcctcatgcag
aacctcttgtctaaggatgtattgtatccatccctgaaggagatcaccgaaaagtatcca
gaatggctacagagtcaccaggagtctattcccccagagcagtttgagaagtatcagcag
cagcacagtgtcatgggcaaaatctgcgagcagttcgaggcagagacgcccacagacagc
gaggctactcacagggctcgctttgaggcggtactcgatcttatgcagcagttacaggac
ttgggccaccctccgaaagagctggctggggagatgcctcctggcctcaactttgacctg
gatgccctcaatctatcgggcccaccaggtgctaatggcgaacagtgtctgatcatgtga

DBGET integrated database retrieval system