KEGG   Rattus norvegicus (rat): 102548682
Entry
102548682         CDS       T01003                                 

Definition
(RefSeq) uncharacterized protein LOC102548682
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102548682
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102548682
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102548682
  09165 Substance dependence
   05034 Alcoholism
    102548682
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    102548682
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    102548682
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    102548682
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102548682
SSDB
Motif
Pfam: Histone CENP-T_C TAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP PAF Couple_hipA
Other DBs
NCBI-GeneID: 102548682
NCBI-ProteinID: XP_017456208
RGD: 7725170
Ensembl: ENSRNOG00000045646
Position
17
AA seq 342 aa
MNQRLFSEPHTVSNMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKR
ISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRRSPGSVHVSS
FGSEMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQ
KSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCVLTTM
SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKV
FLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgaaccaaaggctcttttcagagccacacacggtttcaaatatgtccggtcgcggcaaa
ggagggaaaggcctgggcaaaggcggcgctaagcgccaccgcaaagtcctgcgcgacaac
atccaggggatcactaagcccgccatccgccgcctggcccggcgcggaggagtgaagcgc
atctccggcctcatctacgaggagacccgcggtgtgctgaaggtgttcctggagaacgta
atccgcgacgccgtcacctacacggagcacgccaagcgcaagaccgtcactgctatggac
gtggtctacgcgcttaaacgccagggccgcaggagccctgggtcagtccatgtttcttct
ttcggtagtgaaatggctcgtactaagcagaccgctcgcaagtccaccggcggcaaagcc
ccgcgcaagcagctcgccaccaaggctgcccgcaagagcgccccggccaccggcggcgtg
aagaagccccaccgctaccgtcccggcaccgttgctctgcgcgagatccggcgctaccag
aagtccaccgagctgctgatccgcaagctgccgttccagcgcctggtgcgcgaaatcgcg
caggacttcaagaccgaccttcgcttccagagctcggcggtcatggcccttcaggaggcc
agcgaggcctaccttgtgggtctgtttgaggacaccaatctgtgcgtactcacaaccatg
tctggacgtggtaaaggtggtaaaggccttgggaaaggtggcgctaagcgtcatcgcaaa
gtcctgcgcgacaatatccagggcatcacaaagcccgccatccgccgcctggcccggcgc
ggaggagtgaagcgcatctccggcctcatctacgaggaaacccgcggtgtgctgaaggtg
ttcctggagaacgtgatccgcgacgccgtcacctacacggagcacgccaagcgcaagacg
gtcactgccatggacgtggtctacgcgcttaaacgccagggccgcacactctacggcttc
ggtggttaa

DBGET integrated database retrieval system