KEGG   Rattus norvegicus (rat): 102548682Help
Entry
102548682         CDS       T01003                                 

Definition
(RefSeq) histone H4-like
  KO
K11254  histone H4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102548682
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102548682
  09165 Substance dependence
   05034 Alcoholism
    102548682
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    102548682
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    102548682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 102548682
NCBI-ProteinID: XP_017443211
RGD: 7725170
Ensembl: ENSRNOG00000045646
UniProt: D3ZJ08
Position
17p11
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccaccggcggcaaagccccgcgcaagcag
ctcgccaccaaggctgcccgcaagagcgccccggccaccggcggcgtgaagaagccccac
cgctaccgtcccggcaccgttgctctgcgcgagatccggcgctaccagaagtccaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgaaatcgcgcaggacttcaag
accgaccttcgcttccagagctcggcggtcatggcccttcaggaggccagcgaggcctac
cttgtgggtctgtttgaggacaccaatctgtgcgccatccacgccaagcgtgtgaccatc
atgcccaaggacatccagctggcccgccgcattcgtggcgagagggcttaa

DBGET integrated database retrieval system