KEGG   Rattus norvegicus (rat): 102549173
Entry
102549173         CDS       T01003                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC102549173
  KO
K11253  histone H3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno05034  Alcoholism
rno05202  Transcriptional misregulation in cancer
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    102549173
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102549173
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102549173
  09165 Substance dependence
   05034 Alcoholism
    102549173
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    102549173
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    102549173
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    102549173
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102549173
SSDB
Motif
Pfam: Histone PAF CENP-T_C
Other DBs
NCBI-GeneID: 102549173
NCBI-ProteinID: XP_006254041
RGD: 7709329
Ensembl: ENSRNOG00000050478
UniProt: D3ZJ08
Position
17
AA seq 253 aa
MNLWRATFEMLQGQSKCFYVYLRARFFLPSTLVYPFYGMARTKQTARKSTGGKAPRKQLA
TKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTD
LRFQSSAVMALQEASEAYLVGLFEDTNLCSIVLLGHQGKGKPLAKAGLSAHRKVLRDNIQ
GITKPAIRRLARCGGVKRISGLIYKETRGMLKVFLENVIRDAVTYLEQANRKTAMDVVYT
LKRQGRTLYGFGG
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaatttgtggcgcgcgactttcgaaatgttgcaaggccaatcaaaatgtttctacgtc
tatttaagggcaagattctttcttccttctacattggtttatcctttttacgggatggca
cgtactaagcagaccgctcgaaagtccacgggcggcaaagccccgcgcaagcagctcgcc
accaaggccgcccgcaagagcgctccggccaccggcggcgtgaagaagccccaccgctac
cgtcccggcaccgtggctctgcgcgagatccggcgctaccagaagtccaccgagctgctg
atccgcaagctgccgttccagcgcctggtgcgcgaaatcgcgcaggacttcaagaccgac
cttcgcttccagagctcggcggtcatggcccttcaggaggccagcgaggcctaccttgtg
ggtctgtttgaggacaccaacctgtgcagcatagtcttgttggggcaccaggggaaaggg
aagcccttggcaaaggcggggctaagcgcccaccgcaaagtcttgcgcgacaatatccag
ggcatcaccaagcccgccatccgccgcctggctcggtgcggaggggtgaagcgcatctct
ggcctcatctacaaggagacccgcggtatgctgaaggtgttcctggagaacgtgatccgc
gacgccgtcacctaccttgagcaagccaatcgcaagactgccatggatgtggtctatact
ctcaagcgccagggccgcactctctatggcttcggcggctga

DBGET integrated database retrieval system