KEGG   Rattus norvegicus (rat): 102549542Help
Entry
102549542         CDS       T01003                                 

Definition
(RefSeq) elongation of very long chain fatty acids protein 6-like
  KO
K10203  elongation of very long chain fatty acids protein 6 [EC:2.3.1.199]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00062  Fatty acid elongation
rno01040  Biosynthesis of unsaturated fatty acids
rno01100  Metabolic pathways
rno01212  Fatty acid metabolism
Module
rno_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    102549542
   01040 Biosynthesis of unsaturated fatty acids
    102549542
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rno01004]
    102549542
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     102549542
Lipid biosynthesis proteins [BR:rno01004]
 Elongase
  PUFA
   102549542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 102549542
NCBI-ProteinID: XP_008759707
RGD: 7527008
Ensembl: ENSRNOG00000048949
UniProt: Q920L6
Position
2q43
AA seq 267 aa AA seqDB search
MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELR
KPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSK
APELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSY
YALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLM
YLSYLLLFCHFFFEAYIGKVKKATKAE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgtcagtgttgactttacaagaatatgaattcgagaagcagttcaacgagaat
gaagccatccaatggatgcaggaaaactggaagaaatctttcctgttttctgcgctgtac
gctgcctttatatttggtggtcggcatctgatgaacaagcgggccaagtttgaactgcgg
aagccgctcgtgctctggtcactgactcttgcggtcttcagtatattcggtgctcttcga
actggtgcttacatgctgtacattttgatgaccaaaggcctgaagcagtcagtttgtgac
cagagtttttacaacggacctgtcagcaaattctgggcttacgcgtttgtgctcagcaaa
gcacccgaactaggtgatacgatattcatcattctgaggaagcagaagctgatcttcctg
cactggtaccaccacatcactgtgctcctgtactcttggtactcctacaaagacatggta
gctgggggtggttggttcatgactatgaactatggcgtacacgccgtcatgtactcttac
tacgccttgcgggctgcgggtttccgggtctcccggaagtttgccatgttcatcacgttg
tcccagatcactcagatgctgatgggctgtgtcattaactacctggtcttcaactggatg
cagcatgacaatgaccagtgctactcccactttcagaacatcttctggtcctcactcatg
tacctcagctaccttctgctcttctgccatttcttctttgaggcctacatcggcaaagtg
aagaaagcgacgaaggccgagtag

DBGET integrated database retrieval system