KEGG   Rattus norvegicus (rat): 102549803
Entry
102549803         CDS       T01003                                 

Gene name
Nat8f4
Definition
(RefSeq) N-acetyltransferase family 8 member 2-like
  KO
K20838  N-acetyltransferase 8 [EC:2.3.1.80 2.3.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102549803 (Nat8f4)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.80  cysteine-S-conjugate N-acetyltransferase
     102549803 (Nat8f4)
    2.3.1.-  
     102549803 (Nat8f4)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_9 Acetyltransf_CG FR47 Acetyltransf_4 Acetyltransf_3 Acetyltransf_13 Acetyltransf_8
Other DBs
NCBI-GeneID: 102549803
NCBI-ProteinID: XP_006236880
RGD: 7636572
Ensembl: ENSRNOG00000057086
UniProt: M0RDW3
Position
4
AA seq 226 aa
MAPYHIRQFQDRDHRRVLDLFSRGMEEHVPAAFYHVLTLPHSLLLFPGVPVTIILVSGSW
LLATVYSFLFLLCLRLLIWFSWRNYVAMCLKSDLADITKSYLNAHGSFWVAESGGQVVGI
VGSLPVKEPPSGRRQLQLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLQTSSVQ
YSAMSLYQGMGFQKTGQHFMSITTRLIGLPIFHFTYSLPSVWEPRM
NT seq 681 nt   +upstreamnt  +downstreamnt
atggctccttatcacatcagacagttccaggacagggaccacagaagagtcctggacttg
ttctccagaggcatggaggagcatgtccctgctgccttctaccatgtgctgacactgcct
cattctctcctgctctttcctggggtgcccgtgaccataatcctagtgtctggctcttgg
ctcctggccacagtgtacagtttcctctttctcctttgcctgcggctccttatctggttt
tcatggagaaattatgtggctatgtgtttgaaatcagacctggctgacatcaccaagtct
tacctgaatgcacatggctccttctgggtggctgagtctggggggcaggtggtgggcata
gtgggaagtctgccagtcaaggagcctccatcagggaggaggcagctgcagctctttcgc
ctgtctgtgtcctcacagcatcgaggacaggggatagcaaaagcactggtcagaactgtg
ctccagtttgcacgggaccagggctacacggatgttgtcctacagaccagcagtgtgcag
tacagcgctatgtctctgtaccagggcatgggcttccagaagacaggccagcactttatg
agcataaccacgaggttaattggtcttcctatctttcatttcacctactctctcccttct
gtctgggaaccaaggatgtga

KEGG   Rattus norvegicus (rat): 113892
Entry
113892            CDS       T01003                                 

Gene name
Nat8f3
Definition
(RefSeq) N-acetyltransferase family 8 member 3
  KO
K20838  N-acetyltransferase 8 [EC:2.3.1.80 2.3.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113892 (Nat8f3)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.80  cysteine-S-conjugate N-acetyltransferase
     113892 (Nat8f3)
    2.3.1.-  
     113892 (Nat8f3)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_4 Acetyltransf_CG FR47 Acetyltransf_9 Acetyltransf_3
Other DBs
NCBI-GeneID: 113892
NCBI-ProteinID: NP_543159
RGD: 621607
Ensembl: ENSRNOG00000015763
Position
4
AA seq 228 aa
MAPYHIRKYQDSDHRSVVNLFCRGTEEHISASFRYMLLLPGTLLILLGVPLTLFLASGSW
LLVLLSTLTLLVSLWLLAKYPWEKYTAMCLHSDMADIPRTYLSSHYSCFWVAESRGQMVG
IIAVLPVKDPLLQRKQLQLRHLSVSLEHRREGIGRAMVRTALQFAEMQGFSEVVLVTSML
QYAALALYQSMGFQKTGEFFYTFVSRLRNSPMICLKYCLTSALNDLKT
NT seq 687 nt   +upstreamnt  +downstreamnt
atggctccttatcatatccgaaaataccaggacagcgaccacaggagtgtagtgaatttg
ttctgcagaggcacggaggagcacatctccgccagcttccgctacatgctgctgctgccc
ggaaccctcctgatcttactcggggtccctcttactctattcttggcctcaggctcctgg
cttctggttcttctgtccacccttaccctccttgtttccctgtggctccttgcaaaatac
ccttgggagaagtatacggcaatgtgtttgcactcagacatggctgatatccccagaacc
tacttgagttctcattactcctgcttctgggtggctgagtctagaggtcagatggtgggc
ataatcgctgttttaccagtgaaggatcccctcctgcagaggaagcaactgcagctacgt
cacctctctgtgtccctggagcaccggagagaggggattggaagagctatggtcaggact
gccctccagtttgcagagatgcagggcttcagtgaagttgtcctggtcaccagcatgttg
cagtatgctgccctagctctgtaccagagcatgggcttccagaagactggtgagttcttc
tatacctttgtctctcgactaaggaattctccaatgatatgcttaaaatattgcctcact
tctgctctgaatgacctgaaaacctga

KEGG   Rattus norvegicus (rat): 114020
Entry
114020            CDS       T01003                                 

Gene name
Nat8f5
Definition
(RefSeq) probable N-acetyltransferase CML5
  KO
K20838  N-acetyltransferase 8 [EC:2.3.1.80 2.3.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    114020 (Nat8f5)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.80  cysteine-S-conjugate N-acetyltransferase
     114020 (Nat8f5)
    2.3.1.-  
     114020 (Nat8f5)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_CG Acetyltransf_9 Acetyltransf_4 Acetyltransf_8 FR47 Acetyltransf_3
Other DBs
NCBI-GeneID: 114020
NCBI-ProteinID: NP_543160
RGD: 621610
Ensembl: ENSRNOG00000015768
UniProt: B0BN17
Position
4
AA seq 227 aa
MALYQIRQYQERDHKHVVDLFSSGIKEHIPAAFRYTLLLPKTLLFLFAAPLTIVLASGSW
LLAVVCIFFLLLLLRFLAGQPFKEYVAMCLQTDMADITKSYLNAHGSFWVAESGGQVVGI
VAALPVKESPSGRKQLQLFHLSVSSQCRGQGIAKALVRTVLQFARDQGYMDVVLETSIIQ
QGAMTLYEAMGFQRTGKNLENSIIKWLIGFFLFRFTYAFPSAQEHEL
NT seq 684 nt   +upstreamnt  +downstreamnt
atggctctttatcagatccgccagtaccaggagagggaccacaaacacgttgtggacttg
ttctccagtggcatcaaggagcacatccccgccgccttccgctacacgctgctgctgccc
aagaccctcctgtttttatttgcagcgcctctgaccatagtcctggcgtctggctcctgg
ctgctggctgttgtatgcatcttcttcctgctcctactcctgcggttccttgctggacag
cccttcaaggagtatgtggccatgtgtttgcagacagacatggctgacatcaccaagtct
tacctgaatgcacatggctccttctgggtggctgagtctggggggcaggtggtgggcata
gtggctgctctgccagtcaaggagtctccatcagggaggaagcagctgcagctcttccac
ctgtctgtgtcctcacagtgtcgaggacaggggatagcgaaagcactggtcagaactgtg
ctccagtttgcacgggaccagggctacatggatgttgtccttgagaccagtatcatacag
caaggtgctatgaccctctacgaggctatgggattccaaaggacagggaaaaacttagag
aacagcattattaagtggttaattgggttttttttatttcgtttcacgtatgctttccct
tctgctcaggaacatgaactgtaa

KEGG   Rattus norvegicus (rat): 500237
Entry
500237            CDS       T01003                                 

Gene name
Nat8f2
Definition
(RefSeq) N-acetyltransferase family 8 member 2
  KO
K20838  N-acetyltransferase 8 [EC:2.3.1.80 2.3.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    500237 (Nat8f2)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.80  cysteine-S-conjugate N-acetyltransferase
     500237 (Nat8f2)
    2.3.1.-  
     500237 (Nat8f2)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_9 Acetyltransf_CG FR47 Acetyltransf_4 Acetyltransf_3 Acetyltransf_13 Acetyltransf_15
Other DBs
NCBI-GeneID: 500237
NCBI-ProteinID: NP_001166920
RGD: 1561619
Ensembl: ENSRNOG00000057968
UniProt: M0R784
Position
4
AA seq 226 aa
MAPYHIRQFQDRDHRRVLDLFSRGMEEHVPAAFYHVLTLPHSLLLFPGVPVTIILVSGSW
LLATVYSFLFLLCLRLIFWVSCRNYVAKCLQADLADITKSYLNAHGSFWVAESGGQVVGI
VAALPVKEPPSGRKQLQLFRLSVSSQHRGQGIAKALVRIVLQFARDQGYTDVVLVTGNMQ
YSAMSLYQGMGFQKTGHYFVSIAKRLIGLSIFHFTYSLPSVWEPRM
NT seq 681 nt   +upstreamnt  +downstreamnt
atggctccttatcacatcagacagttccaggacagggaccacagaagagtcctggacttg
ttctccagaggcatggaggagcatgtccctgctgccttctaccatgtgctgacactgcct
cattctctcctgctctttcctggggtgcccgtgaccataatcctagtgtctggttcttgg
ctcctggccacagtgtacagtttcctctttctcctttgcctgcggctcattttctgggtt
tcatgcagaaattatgtggctaaatgtttgcaggccgacttggctgacatcaccaagtct
tacctgaatgcacatggctccttctgggtggctgagtctggggggcaggtggtgggcata
gtggctgctctgccagtcaaggagcctccatcagggaggaagcagttgcagctcttccgc
ctgtctgtgtcctcacagcatcgaggacaggggatagcgaaagcactggtcagaattgtg
ctccagtttgcacgggaccagggctacacggatgttgtccttgtgactggcaatatgcag
tatagcgctatgtctctgtaccagggcatgggcttccagaagacaggccattacttcgtc
agcatagccaagaggttaattggtctttctatctttcatttcacctactctctcccttct
gtttgggaaccaagaatgtga

KEGG   Rattus norvegicus (rat): 59300
Entry
59300             CDS       T01003                                 

Gene name
Nat8f1
Definition
(RefSeq) probable N-acetyltransferase CML1
  KO
K20838  N-acetyltransferase 8 [EC:2.3.1.80 2.3.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    59300 (Nat8f1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.80  cysteine-S-conjugate N-acetyltransferase
     59300 (Nat8f1)
    2.3.1.-  
     59300 (Nat8f1)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_CG Acetyltransf_9 FR47 Acetyltransf_3 DUF5493 Acetyltransf_8 Acetyltransf_13
Other DBs
NCBI-GeneID: 59300
NCBI-ProteinID: NP_067700
RGD: 621606
Ensembl: ENSRNOG00000015799
UniProt: Q9QXT4 V9GZ80
Position
4
AA seq 231 aa
MPRFETQKSPMAPYHIRQYQDSDHKSVVDVFTKGMEEHIPSTFRHMLMLPRTLLLLLGVP
LALVLVSGSWLLAVVCIFFLLLLLRFLAGQPWKEYVATCLRTDMADITKSYLNAHGSFWV
AESGNQVVGIVAALPVKDPPSGRKQLQLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYT
DVVLETSTLQQGAMTLYLGMGFQKTGQRFLTMFWRLVGIRTIQLKYPFPSA
NT seq 696 nt   +upstreamnt  +downstreamnt
atgccaagatttgagacccagaagtctcccatggctccttatcacatccgccagtaccaa
gacagcgaccacaaaagtgtcgtggatgtgttcaccaagggcatggaagaacacatcccc
tccaccttccgccacatgcttatgctgccccgaaccctcctactcttacttggggtgccc
cttgccctggtcctggtgtctggctcctggctgctggctgttgtatgcatcttctttctg
ctcctactcctgcggttccttgctggacagccctggaaggagtatgtggctacatgtttg
cggacagacatggctgacatcaccaagtcttacctgaatgcacatggctccttctgggtg
gctgagtctggaaaccaggtggtgggcatagtggctgctctgccagtcaaggatcctcca
tcagggaggaagcagctgcagctctttcgcctgtctgtgtcctcacagcatcgaggacag
gggatagcgaaagcactggtcagaactgtcctccagtttgcacgggaccagggctacact
gatgttgtccttgagaccagtaccttgcaacaaggtgctatgaccctctacctgggcatg
ggcttccagaagacaggccaacgcttcctgactatgttctggaggttagtgggtattcgg
acaattcaattaaagtatcccttcccttctgcctag

KEGG   Rattus norvegicus (rat): 64570
Entry
64570             CDS       T01003                                 

Gene name
Nat8
Definition
(RefSeq) N-acetyltransferase 8
  KO
K20838  N-acetyltransferase 8 [EC:2.3.1.80 2.3.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    64570 (Nat8)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.80  cysteine-S-conjugate N-acetyltransferase
     64570 (Nat8)
    2.3.1.-  
     64570 (Nat8)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_9 Acetyltransf_CG FR47 Acetyltransf_3 Acetyltransf_4 Acetyltransf_15 Acetyltransf_13 DUF3887 HCV_capsid DUF4131
Other DBs
NCBI-GeneID: 64570
NCBI-ProteinID: NP_072157
RGD: 621609
UniProt: Q9QXT3
Position
4
AA seq 222 aa
MASFHIRQFQERDYEQVVDMFSRGMKEHIPTAFRHLLLLPRTLLLLLGVPLALVLVSGSW
LLAVVCIFFLLPFLWFLAGQPWKNYVSKCLHTDMADITKSYLSDRGSGFWVAESGGQIVG
TVGALPVKDPPSGRKQLQLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLVTGLL
QQGAVTLYYSMGFQKTGESFMDILTWLVDVSLIHFIYPLPSS
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcttcttttcacatccgccagttccaggagagggactatgaacaggtcgtggatatg
ttctccaggggaatgaaggaacacatccccactgccttccgccacttgctgctgctgccc
cgaaccctcctactcttacttggggtgccccttgccctggtcctggtgtctggctcctgg
ctgctggctgttgtatgcatcttctttctgctcccatttttgtggttccttgctggacag
ccctggaagaattatgtgtccaaatgcttacacacagacatggctgacatcaccaagtct
tatctgagtgatcgtggctcaggtttctgggtggctgagtctgggggccagatagtgggc
acagtgggtgctctgccagtcaaggatcctccatcagggaggaagcagttgcagctcttc
cgcctgtctgtgtcctcacagcatcgaggacaggggatagcgaaagcactggtcagaact
gtgctccagtttgcacgggaccagggctacacggatgttgtccttgtgactggccttttg
cagcaaggtgctgtgaccctctactacagcatgggcttccagaagacaggcgaatccttc
atggacatactcacatggcttgtggatgtttctctaattcatttcatatacccgctccct
tcctcctga

DBGET integrated database retrieval system