KEGG   Rattus norvegicus (rat): 102551071
Entry
102551071         CDS       T01003                                 

Definition
(RefSeq) myosin light polypeptide 6-like
  KO
K12751  myosin light chain 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04530  Tight junction
rno04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    102551071
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102551071
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102551071
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    102551071
   04147 Exosome [BR:rno04147]
    102551071
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     102551071
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102551071
  Exosomal proteins of bladder cancer cells
   102551071
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 EF-hand_9
Other DBs
NCBI-GeneID: 102551071
NCBI-ProteinID: XP_006249672
RGD: 7517597
Ensembl: ENSRNOG00000056798
Position
13
AA seq 151 aa
MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCRDVMRALGQNPTNAEVLKVLGNPKSHEM
NVKVLDFEHFLPMLQTMTKNKNQGTYEDYFEDLRVFDKEGNGTVMDAEIHHVLVTLCEKM
TEEEVEMLVAGHVDSNGCINLEELVRLVLNG
NT seq 456 nt   +upstreamnt  +downstreamnt
atgtgtgacttcaccgaagaccagaccgcagaattcaaggaggcttttcagctgtttgac
cgaacaggcgatggcaagatcctgtacagccagtgtagggatgtgatgcgggccctgggc
cagaaccctaccaacgccgaggtgctcaaagtcctggggaaccccaagagtcatgagatg
aatgtgaaggtgctggactttgagcacttcctgcccatgctgcagactatgaccaagaac
aagaaccaaggaacttacgaggattattttgaagaccttcgtgtgtttgacaaagaaggg
aatggcactgtcatggatgctgaaatccatcatgttctagtcacactgtgtgagaagatg
acagaggaagaagtagagatgctagtggcggggcatgtggacagcaacggttgcatcaac
cttgaagagcttgtccggttggtgctgaatggctga

KEGG   Rattus norvegicus (rat): 296313
Entry
296313            CDS       T01003                                 

Gene name
Myl9
Definition
(RefSeq) myosin regulatory light polypeptide 9
  KO
K12755  myosin regulatory light chain 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04270  Vascular smooth muscle contraction
rno04360  Axon guidance
rno04510  Focal adhesion
rno04530  Tight junction
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno04921  Oxytocin signaling pathway
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    296313 (Myl9)
   04022 cGMP-PKG signaling pathway
    296313 (Myl9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    296313 (Myl9)
   04530 Tight junction
    296313 (Myl9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    296313 (Myl9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    296313 (Myl9)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    296313 (Myl9)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    296313 (Myl9)
  09158 Development and regeneration
   04360 Axon guidance
    296313 (Myl9)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    296313 (Myl9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    296313 (Myl9)
   04147 Exosome [BR:rno04147]
    296313 (Myl9)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     296313 (Myl9)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   296313 (Myl9)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_11 GPHH SPARC_Ca_bdg DUF3741
Other DBs
NCBI-GeneID: 296313
NCBI-ProteinID: NP_001094355
RGD: 1311235
Ensembl: ENSRNOG00000020246
UniProt: Q64122
Position
3
AA seq 172 aa
MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
LGKNPTDEYLEGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtccagcaagagagccaaggccaagaccaccaagaagaggccccagagggctacgtcc
aatgtcttcgctatgtttgaccagtcccagatccaggagtttaaggaggccttcaacatg
attgatcagaaccgtgatggcttcattgacaaggaggacctacatgacatgctggcctcc
ctggggaagaaccccacggatgagtacctggagggtatgatgaacgaggccccgggacct
atcaacttcaccatgttcctcactatgtttggggagaagctgaacggcacagaccccgag
gacgtgatccgcaatgcctttgcctgctttgatgaggaagcctcagggttcatccacgag
gaccacctgcgggagctgctcaccaccatgggcgaccgattcacggatgaggaggtggac
gagatgtaccgtgaggcgcccattgataagaagggcaacttcaactatgtggagttcact
cgcatcctcaagcacggcgccaaggacaaagacgactag

KEGG   Rattus norvegicus (rat): 304447
Entry
304447            CDS       T01003                                 

Gene name
RGD1559821
Definition
(RefSeq) myosin light polypeptide 6-like
  KO
K12751  myosin light chain 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04530  Tight junction
rno04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    304447 (RGD1559821)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    304447 (RGD1559821)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    304447 (RGD1559821)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    304447 (RGD1559821)
   04147 Exosome [BR:rno04147]
    304447 (RGD1559821)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     304447 (RGD1559821)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   304447 (RGD1559821)
  Exosomal proteins of bladder cancer cells
   304447 (RGD1559821)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_9 EF-hand_5
Other DBs
NCBI-GeneID: 304447
NCBI-ProteinID: XP_006249352
RGD: 1559821
Ensembl: ENSRNOG00000008521
Position
12
AA seq 151 aa
MCDFTEDQTTEFKEAFQLFDRTGNGKILYSQCGDVMRALGQNPTNTEVLKVLGNPKSDEM
NVEVLDFEHFLPMLQTVAKSKDQGTYEDYVEGLHVFDKEGNSAVLGAEIRHILVTLGENM
TEEEVEMLVAGHEDSNSCINYEELVRMVLNG
NT seq 456 nt   +upstreamnt  +downstreamnt
atgtgtgacttcaccgaggaccagaccacagaattcaaggaggctttccagctgtttgac
cgaacaggcaatggcaagatcctgtacagccagtgtggggatgtgatgcgggccctgggc
cagaaccctaccaacaccgaggtgctcaaggtcctggggaaccccaagagcgatgagatg
aatgtggaggttctggactttgagcacttcctgcccatgctgcagaccgtggccaagagc
aaggaccaaggaacctatgaggattatgttgaaggtcttcatgtgtttgacaaagaaggg
aacagcgctgtcctgggtgctgaaatccgtcatatcctagtcacgctgggcgagaatatg
acagaggaagaagtagagatgctagtggcagggcatgaggacagcaacagttgcatcaac
tatgaagagctcgtccggatggtgctgaatggctaa

KEGG   Rattus norvegicus (rat): 685867
Entry
685867            CDS       T01003                                 

Gene name
Myl6
Definition
(RefSeq) myosin light polypeptide 6
  KO
K12751  myosin light chain 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04530  Tight junction
rno04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    685867 (Myl6)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    685867 (Myl6)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    685867 (Myl6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    685867 (Myl6)
   04147 Exosome [BR:rno04147]
    685867 (Myl6)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     685867 (Myl6)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   685867 (Myl6)
  Exosomal proteins of bladder cancer cells
   685867 (Myl6)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 EF-hand_9
Other DBs
NCBI-GeneID: 685867
NCBI-ProteinID: NP_001102954
RGD: 1589019
Ensembl: ENSRNOG00000054140
UniProt: A0A0G2K6J5
Position
7
AA seq 151 aa
MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM
NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM
TEEEVEMLVAGHEDSNGCINYEELVRMVLNG
NT seq 456 nt   +upstreamnt  +downstreamnt
atgtgtgacttcaccgaggaccagaccgcagaattcaaggaggctttccagctgtttgac
cgaacaggcgatggcaagatcctgtacagccagtgtggggatgtgatgcgggccctgggc
cagaaccctaccaacgccgaggtgctcaaggtcctggggaaccccaagagcgatgagatg
aatgtgaaggtgctggactttgagcacttcctgcccatgctgcagactgtggccaagaac
aaggaccaaggaacctacgaggattatgttgaaggccttcgtgtgtttgacaaagaaggg
aatggcactgtcatgggtgctgaaatccgtcatgtcctagtcacactgggggagaagatg
acagaggaagaagtcgagatgctagtggcggggcatgaggacagcaacggttgcattaac
tatgaagagcttgtccggatggtgctgaatggctga

DBGET integrated database retrieval system