KEGG   Rattus norvegicus (rat): 102551431
Entry
102551431         CDS       T01003                                 

Definition
(RefSeq) profilin-2-like
  KO
K05759  profilin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05014  Amyotrophic lateral sclerosis
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102551431
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102551431
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102551431
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102551431
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    102551431
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    102551431
   04147 Exosome [BR:rno04147]
    102551431
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    102551431
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     102551431
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   102551431
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 102551431
NCBI-ProteinID: XP_006257170
RGD: 7509912
Position
X
AA seq 130 aa
MCSDAAVIANCPPWLLASSTEGNFIQMTQEEVQTLLTREGREKLFLQGVTLAGIKCLLIR
DNLFTHGNNSMDLRTKGQSRGSQAVTVVQMESVYLVVMGKKGTEGGPLNLKAFEIAGYMR
EAILQKMAHC
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtgcagtgatgcagcagttattgccaattgtccaccctggttattagcttcttctact
gaagggaactttattcagatgacccaggaagaagttcagaccttgctgacaagagagggt
agagaaaagctgtttctccagggagtcacccttgctggaatcaaatgcctgttgatccga
gacaacttgttcacccatggcaataacagcatggacctccgtaccaaaggccaaagtcga
ggtagccaggcagtgactgtagttcagatggagtctgtgtatcttgtggtgatgggaaag
aaggggacagaaggaggacctctcaacctcaaagcttttgagatagcaggctacatgaga
gaggccattcttcaaaaaatggctcattgctaa

KEGG   Rattus norvegicus (rat): 171436
Entry
171436            CDS       T01003                                 

Gene name
Mk1
Definition
(RefSeq) Mk1 protein
  KO
K05759  profilin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05014  Amyotrophic lateral sclerosis
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    171436 (Mk1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    171436 (Mk1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    171436 (Mk1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    171436 (Mk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    171436 (Mk1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    171436 (Mk1)
   04147 Exosome [BR:rno04147]
    171436 (Mk1)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    171436 (Mk1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     171436 (Mk1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   171436 (Mk1)
SSDB
Motif
Pfam: Profilin DUF4543
Other DBs
NCBI-GeneID: 171436
NCBI-ProteinID: NP_599226
RGD: 621165
Ensembl: ENSRNOG00000019657
UniProt: Q8VHI2
Position
16
AA seq 125 aa
MARWQMAPVRTRPLAIVGYKDLPSIWAAIPGKNFVSITLAEFGLMVGKDWSSFFMNSLTL
GGQKMFCDPGLTAASRGIYNGSSYQEHWRNPHLQCHCTMTAKMLLLMGKEGTHGGWINNH
GGWML
NT seq 378 nt   +upstreamnt  +downstreamnt
atggcacggtggcagatggcacctgtcaggacacggccattggccattgtaggctacaag
gatttgccctccatctgggctgccatccctgggaagaacttcgttagcattacacttgct
gagtttggtctcatggtaggcaaagactggtcaagttttttcatgaatagcttgacgctt
gggggccaaaaaatgttctgtgatccaggactcactgctgcaagtcggggaatttacaat
gggtcttcataccaagagcactggaggaacccccaccttcaatgtcactgcaccatgact
gccaagatgctcctgctgatgggcaaagaaggtacccacggtggttggatcaacaaccac
ggtggttggatgttgtga

KEGG   Rattus norvegicus (rat): 494222
Entry
494222            CDS       T01003                                 

Gene name
Pfn4
Definition
(RefSeq) profilin-4
  KO
K05759  profilin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05014  Amyotrophic lateral sclerosis
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    494222 (Pfn4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    494222 (Pfn4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    494222 (Pfn4)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    494222 (Pfn4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    494222 (Pfn4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    494222 (Pfn4)
   04147 Exosome [BR:rno04147]
    494222 (Pfn4)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    494222 (Pfn4)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     494222 (Pfn4)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   494222 (Pfn4)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 494222
NCBI-ProteinID: NP_001009503
RGD: 1359707
Ensembl: ENSRNOG00000050386
UniProt: Q5IRJ7
Position
6
AA seq 129 aa
MSHLQNLLLDTLLGTKHVDGAALIKLQEKTLCVTSPGFSVMPCDVRTLLNGFAKNPLLTR
REGLYFREKDYKCVRADDCSLYAKKENTGVVVVKTHMYLLVATYTAGMYPSVCVEATEKL
GEYLRKKGN
NT seq 390 nt   +upstreamnt  +downstreamnt
atgagtcacttgcaaaacttactgttagataccctactggggacgaagcatgtggacggt
gcagccctcatcaaactccaagaaaagaccctgtgtgtgacatcaccaggatttagtgta
atgccatgtgatgttcgaacacttttgaatggatttgccaaaaacccattattaacccga
agggaagggttgtatttcagggaaaaggattacaaatgtgtccgggcagatgactgttct
ctctatgctaagaaggagaacactggtgtggtggtggtgaagacccacatgtatcttctg
gtggcaacctacactgcaggcatgtatcctagtgtctgcgtggaagccacagagaagctg
ggagagtatctaagaaaaaaaggaaactaa

KEGG   Rattus norvegicus (rat): 64303
Entry
64303             CDS       T01003                                 

Gene name
Pfn1
Definition
(RefSeq) profilin-1
  KO
K05759  profilin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05014  Amyotrophic lateral sclerosis
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    64303 (Pfn1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    64303 (Pfn1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    64303 (Pfn1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    64303 (Pfn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64303 (Pfn1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    64303 (Pfn1)
   04147 Exosome [BR:rno04147]
    64303 (Pfn1)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    64303 (Pfn1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     64303 (Pfn1)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   64303 (Pfn1)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 64303
NCBI-ProteinID: NP_071956
RGD: 621825
Ensembl: ENSRNOG00000003975
UniProt: P62963
Position
10
AA seq 140 aa
MAGWNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFF
VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVH
GGLINKKCYEMASHLRRSQY
NT seq 423 nt   +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacagccttatggcggacgggacctgtcaggacgcg
gccatcgtaggctacaaggactcgccctccgtctgggccgctgtccccgggaagaccttc
gttagcattacgccagctgaggttggtgtcctggtaggcaaagaccggtcaagttttttc
gtgaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcaa
gacggggaatttacaatggatcttcgtaccaagagcaccgggggagcccccaccttcaat
gtcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtttgatcaacaagaaatgttatgaaatggcctctcacctgcggcgttcccagtac
tga

KEGG   Rattus norvegicus (rat): 685936
Entry
685936            CDS       T01003                                 

Gene name
Pfn3
Definition
(RefSeq) profilin-3
  KO
K05759  profilin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05014  Amyotrophic lateral sclerosis
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    685936 (Pfn3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    685936 (Pfn3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    685936 (Pfn3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    685936 (Pfn3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    685936 (Pfn3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    685936 (Pfn3)
   04147 Exosome [BR:rno04147]
    685936 (Pfn3)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    685936 (Pfn3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     685936 (Pfn3)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   685936 (Pfn3)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 685936
NCBI-ProteinID: NP_001102957
RGD: 1587838
Ensembl: ENSRNOG00000047752
UniProt: M0RCP6
Position
17
AA seq 137 aa
MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFL
QTGLSVAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI
LNKTVHDLIGGLREQCS
NT seq 414 nt   +upstreamnt  +downstreamnt
atgggtgactggaagggctacatcagtgcggtgctgcgggatcagcgtatcgatgacgtg
gctatcgtgggccactcggacaatcgctgtgtgtgggcatcacggcctgggggtctgctg
gcggccatctccccgcaggaggtgggtgtgctcaccgggccggaccgacacacctttctg
cagacgggtctgagcgtggcgggtcgccgctgctgcgttatccgtgactacctgctggcc
gagggtgatggcgtactggatgcgcgcaccaaggggctggacgggcgtgcaatctgtgtg
ggtcacacgccacgggcgctcctggtgctcatgggcagacgaggcgtgcatggaggcatc
ctcaataagacagtgcacgatctgattggcggattgcgtgagcagtgctcttag

KEGG   Rattus norvegicus (rat): 81531
Entry
81531             CDS       T01003                                 

Gene name
Pfn2
Definition
(RefSeq) profilin-2
  KO
K05759  profilin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05014  Amyotrophic lateral sclerosis
rno05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    81531 (Pfn2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    81531 (Pfn2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    81531 (Pfn2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    81531 (Pfn2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81531 (Pfn2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    81531 (Pfn2)
   04147 Exosome [BR:rno04147]
    81531 (Pfn2)
Membrane trafficking [BR:rno04131]
 Others
  Actin-binding proteins
   Others
    81531 (Pfn2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     81531 (Pfn2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   81531 (Pfn2)
SSDB
Motif
Pfam: Profilin
Other DBs
NCBI-GeneID: 81531
NCBI-ProteinID: NP_110500
RGD: 621826
Ensembl: ENSRNOG00000017427
UniProt: Q9EPC6
Position
2
AA seq 140 aa
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPAEIDVIIGKDREGFF
TNGLTLGGKKCSVIRDSLYVDSDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF
NT seq 423 nt   +upstreamnt  +downstreamnt
atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc
cagagcatcacgccagcagaaatagatgtgattataggaaaagaccgggaaggtttcttt
accaatggtttgactcttggaggaaagaagtgctctgtgatcagagatagcctatacgtt
gactcggactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac
gttgctgttggcagagctgggagagtcttggtctttgtaatgggaaaagaaggggtccat
ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc
tag

DBGET integrated database retrieval system