KEGG   Rattus norvegicus (rat): 102552182
Entry
102552182         CDS       T01003                                 

Gene name
RGD1565203
Definition
(RefSeq) L antigen family member 3-like
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Pcc1
Other DBs
NCBI-GeneID: 102552182
NCBI-ProteinID: XP_006227268
RGD: 7585162
Ensembl: ENSRNOG00000061511
UniProt: M0R3X9
Position
Xq37
AA seq 198 aa
MQGPDEDDSGGRKGLDEGGEDGRHRPQAADAHPRSQSSATEVDHDSSPRLNSPQDARSQA
APGSSGRGSPAVSGVSAEEAAIIPQDEQVPLLPGPSGDAATTTSRLLEFSVRVPFSSAVE
ADMARRSLVANAQRQLLMVPQEYTVNDSILAVRWTTEDPLLFRISINNFLDQLSLVMRNI
QHLQFVAFKRRRERSRNN
NT seq 597 nt   +upstreamnt  +downstreamnt
atgcagggtccagacgaggacgactcaggtggcagaaaggggcttgacgaaggcggcgag
gatgggcggcataggcctcaagctgccgatgcccatcctaggtctcagagttcggcgact
gaggttgaccacgacagctccccgcgtctgaatagcccacaagatgcccgcagtcaggcc
gctcctggcagctccggccgggggagccccgcagtgtcaggagtgtcagctgaagaggcc
gccatcattccccaggacgagcaggtgccacttctccctggacccagcggagacgctgca
acaactacaagtcggctcctggagttctctgtgagagtgcctttctcttctgctgtggag
gcagacatggcacgcaggtccctggtcgccaacgcccagcgtcaactcttaatggttcca
caggagtacactgtgaacgacagtatcttagctgttaggtggactacggaagaccctctt
ctcttccgaatttccatcaacaacttccttgatcaactctccctggtcatgagaaacatt
caacaccttcagtttgtggcttttaaacgaagaagagaaagaagtcgtaataactga

DBGET integrated database retrieval system