KEGG   Rattus norvegicus (rat): 102552324Help
Entry
102552324         CDS       T01003                                 

Definition
(RefSeq) uncharacterized LOC102552324
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4515 NYD-SP28_assoc Anticodon_1
Motif
Other DBs
NCBI-GeneID: 102552324
NCBI-ProteinID: XP_008759245
RGD: 7581938
Ensembl: ENSRNOG00000056545
UniProt: A0A0G2K559
Position
2q26
AA seq 369 aa AA seqDB search
MNSQRPGVQVAHPAVSTYLMMEEIKRLLVAPKRTKLPYSFQASLTGPSERQTSWDDLSHV
YYQMAKHRMLQSAVGKRKNLNSSFDTLAVANHPFRRGHSECSYSRDMVAEDRRRSFPLAP
HATSIAKYCQSQMLMEFNKAEVEATRKLCKNMKETQVALEQLEDTRQPQEPKVLVQAEKS
FLGCLMRKHNQHKKNQQKLRRGHVQECGEIGRRMQMVGLQYQHNKNQIDAEDSPQTLIGQ
MVSSEQEVMPRVLMGETKPKSALGKIQSWELSSGKGSESKISPAINRENQKLWKELEHLA
QDYYRVENTRKQMLKQKEELRNQRWDSVIHGTSIRLAWRDHKQRCPSDPEMLKSSVSSPL
HPTMRINLN
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaactcccaaagacctggagtccaagttgcacacccagccgtaagtacttatctgatg
atggaagaaattaaaaggcttctagttgccccaaagagaactaagttgccttacagcttc
caagctagcttgacaggaccgagtgaacgccagactagctgggatgacctatctcatgtt
tactaccagatggctaaacatcggatgcttcaaagcgctgttggaaagagaaaaaatctt
aactctagctttgatacgttggccgtagccaaccatccgtttcggaggggccatagtgag
tgctcatactcaagggacatggtggctgaggaccgtagacgttccttcccattggcccca
catgcaactagcatagctaagtactgtcagtcacagatgttaatggagttcaacaaggca
gaagtggaggcaactcggaaactgtgtaaaaatatgaaagagactcaggtagccctggag
cagctggaggacactaggcagcctcaggagccaaaggtactggtgcaggctgaaaaatcc
ttcctaggatgcctaatgagaaaacataaccaacataagaagaatcaacagaagctgagg
agaggccacgtccaagaatgtggcgagataggaagaagaatgcaaatggtaggccttcag
taccaacacaataagaaccagattgatgctgaggattcaccgcagacgctgattggtcaa
atggtgtcaagtgaacaggaagttatgccgagggtgctgatgggagagacaaaaccaaaa
tcagccctggggaagatccagtcctgggagttgtcatcaggaaaggggagtgagtctaag
atcagccctgccatcaacagagagaaccagaagttatggaaggaattagaacaccttgct
caagattattacagagtggaaaacacaaggaaacagatgctgaaacaaaaagaagagctg
aggaaccaacgctgggactcagtgatccacgggacatcaataaggctggcgtggcgggat
cataagcaacgatgccccagtgaccctgaaatgctcaagagctccgtaagcagtcccctg
caccctacgatgagaataaatctgaattaa

DBGET integrated database retrieval system