KEGG   Rattus norvegicus (rat): 102552619Help
Entry
102552619         CDS       T01003                                 

Gene name
RGD1561311
Definition
(RefSeq) uncharacterized LOC102552619
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF_N
Motif
Other DBs
NCBI-GeneID: 102552619
NCBI-ProteinID: XP_017453122
RGD: 7567332
Ensembl: ENSRNOG00000027803
UniProt: D4ABY8
Position
10q22
AA seq 206 aa AA seqDB search
MFSCCLRTTRGSGLKKDNRKGHDGVWRGRVLSCLQRLWPFSKKGKNLTKASQGNTDQHTS
AQKDQMEPQRESSIRAQSAVEHMNILVPPLSAYRRIATPLQILDLLFVRHSYLSPYSKED
EQVKNTLWSFLETWMDKNPWMDFCDPSDMLPLQYLEAYLSVYIPNSDLIVRVKILLTQLQ
EKHAKDSQAKDEEDSDLERHILRSTD
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgttctcttgctgtcttcgtactactagaggctcaggcctcaagaaagacaacaggaaa
ggccatgatggtgtctggaggggcagggttctctcatgccttcaacgcctctggccattt
tccaaaaagggaaaaaatttgaccaaggccagccaaggcaacacagaccagcacacttct
gctcaaaaggaccagatggagccccagagagagtcaagcatcagggcacagagtgcagtt
gagcacatgaacatcctggtgcctccgctgtctgcataccgacgtattgccacccctcta
cagatattggacctgctgtttgtgaggcactcatacctcagcccttactctaaagaggat
gaacaagtaaagaacaccctctggagcttcctggaaacatggatggacaagaacccatgg
atggacttttgtgacccatcagacatgttgcctctgcaatacctggaggcctacttgagt
gtgtacatacccaactctgatcttattgtccgggtcaagatcctcctgacccagttgcag
gaaaaacatgccaaggattcacaggccaaagatgaggaagattcagatctggagagacac
atcctcagatcaacagattga

DBGET integrated database retrieval system