KEGG   Rattus norvegicus (rat): 102552838
Entry
102552838         CDS       T01003                                 

Gene name
Mc1r
Definition
(RefSeq) melanocortin 1 receptor
  KO
K04199  melanocortin 1 receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102552838 (Mc1r)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102552838 (Mc1r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    102552838 (Mc1r)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Melanocortin
    102552838 (Mc1r)
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 102552838
NCBI-ProteinID: XP_006222852
RGD: 1312046
UniProt: B6ZGR5
Position
19q12
AA seq 317 aa
MPTQGPPKRLLGSLNSTSITTSHLGLATNQTGSWCLHVSIPDGLFLSLGLVSLVENVLVV
VAITKNRNLHSPMYYFICCLALSDLMVSVSIVLETTIILLLEAGILVARAALVQQLDNVI
DVLICGSMVSSLCFLGVIAIDRYISIFYALRYHSIVTLSRARRAVVGIWVVSIVSSTLFI
TYYKHTAVLLCLVTFFLAMLALMAILYVHMLSRACQHAQGIARLHKRRHSIRQGFCLKGA
ATLTILLGIFFLCWAPFFLHLLLIVLCPQHPTCSCIFKNFNLFLILIILSSIVDPLIYAF
RSQELRMTLKEVLLCSW
NT seq 954 nt   +upstreamnt  +downstreamnt
atgcccactcaggggcccccgaagaggcttctgggttctctcaactccacttccatcacc
acctctcacctcggactggccaccaaccagacagggtcttggtgcctgcatgtgtctatc
ccagatggcctcttcctcagcctggggctggtgagcctggtggagaacgtgttggttgtg
gtagccatcaccaaaaaccgcaacctgcactcgcccatgtattacttcatctgctgtctg
gccctgtctgacctgatggtgagtgtgagcatcgtgctggagaccactatcatcctgctg
ctggaggcaggcatcctggtggcccgcgcggctctggtgcagcagctggacaatgtcatc
gacgtgctcatctgtggctccatggtgtccagtctctgcttcctgggtgtcatcgccata
gaccgctacatctccatcttctacgcgctgcgttaccacagcattgtgacactgtcccgg
gcacgaagggccgtcgtgggcatctgggtggtcagcatcgtctccagcaccctcttcatc
acctactacaaacacacggccgtcctgctctgcctcgtcactttcttcctagccatgctg
gcactcatggcaattctgtatgtccacatgctctctcgagcgtgccagcatgctcagggc
attgcccggctccacaaaaggcggcactccatccgacaaggcttctgtctgaagggcgcc
gccacccttactatccttctggggattttcttcctgtgctgggcccctttcttcctgcac
ctcttgctcatcgttctctgccctcagcaccccacctgcagctgcatcttcaagaacttc
aacctcttcctcatcctcattatcctcagctccatcgtggaccccctcatctacgctttt
cgaagccaggagctccgcatgacactcaaggaggtgctgctgtgctcgtggtga

DBGET integrated database retrieval system