KEGG   Rattus norvegicus (rat): 102553763Help
Entry
102553763         CDS       T01003                                 

Gene name
Znf768
Definition
(RefSeq) zinc finger protein 768
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102553763 (Znf768)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    102553763 (Znf768)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    102553763 (Znf768)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 Zn-ribbon_8 zf-Di19 zf_UBZ zf-met zinc_ribbon_15 XPA_N RNA_pol_Rpb1_R zf-C2HC_2 Zn_ribbon_SprT HypA OrfB_Zn_ribbon zf-LYAR
Motif
Other DBs
NCBI-GeneID: 102553763
NCBI-ProteinID: XP_006223574
RGD: 7609558
Ensembl: ENSRNOG00000029490
UniProt: D3ZGK0
Position
1q37
AA seq 567 aa AA seqDB search
MEREASSWGLEPGDVHSPDAMGSPEGSLKGNTSENEEGEISQEGNGDYEVEEIPFGLEPQ
SPGFEPQSPEFESQSPRFEPESPGFESRSPGFVPPSPEFAPRSPESDPQSPEFESQSSRY
EPQSPGYDPKSPGYEPGSPRYEPKSPGYGSKSPEFESQSPGCESQSPGYEPQNSGDEVRN
SEFKTHSPEFETQSSKFQEGAEMLLNPEEKNPLNIPLGVHPLDSFTQGFGEQPTGALPLG
APFDMPSGALLATPQFEMLQNPLNLTGTLRGPGRRGGRARGGQGPRPNICGICGKSFGRG
STLIQHQRIHTGEKPYKCEVCSKAFSQSSDLIKHQRTHTGERPYKCPRCGKAFADSSYLL
RHQRTHSGQKPYKCPHCGKAFGDSSYLLRHQRTHSHERPYSCPECGKCYSQNSSLRSHQR
VHTGQRPFSCGICGKSFSQRSALIPHARSHAREKPFKCPECGKRFGQSSVLAIHARTHLP
GRTYSCPDCGKTFNRSSTLIQHQRSHTGERPYRCAVCGKGFCRSSTLLQHHRVHSGERPY
KCDDCGKAFSQSSDLIRHQRTHAAGRR
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggaggcgtcgtcgtggggcctcgagcccggggatgtgcacagtcccgacgca
atgggcagtcccgaagggtctctcaaaggcaacacaagtgagaatgaagaaggggaaatt
tctcaagaaggcaatggggactatgaagttgaagaaataccttttgggcttgaaccccaa
agcccaggatttgagccacaaagcccagaatttgaatcccagagccccaggtttgagcct
gaaagcccagggtttgaatcccgaagccctgggtttgtgcccccaagccctgagtttgca
cccagaagtcctgaatcagatcctcagagcccggagtttgaatcccagagttctaggtat
gagccccaaagccctggctatgatcccaagagccctggctacgaacctgggagtcctagg
tatgaacccaaaagccctgggtatggttcaaagagccctgaatttgaatctcaaagccca
gggtgtgaatcccagagtcccgggtatgaaccgcagaactctggagatgaagttcggaat
tctgagttcaaaacccatagccctgaatttgaaactcaaagttccaaattccaggaaggt
gcagagatgcttctgaaccccgaggaaaagaatccattgaacatccccctaggagttcat
cccctggactcctttactcaagggtttggggagcaacccacaggagcactgcctctagga
gcaccatttgatatgccttcgggggctctgctggctacaccccagtttgagatgctccag
aatcccctgaatctgacaggtacccttcgtggtcccggtcgtaggggtggccgggccagg
ggtgggcaaggccctcgacctaacatctgtggcatctgcgggaagagctttgggcgaggc
tcgaccctgatccagcaccagcgcatccacaccggtgagaagccttacaaatgtgaggtg
tgcagcaaggccttttcccagagttctgacctcatcaaacaccagcgcacccatacaggc
gagcggccctacaagtgtcccaggtgcggcaaggcctttgctgatagttcttacctactt
cgccaccagcgcacccactctggccagaagccctacaagtgtccacactgtgggaaggct
tttggtgacagctcctacctcctgcggcaccagcgcacccacagccacgagcggccctac
agctgccctgagtgtggcaagtgctatagccagaactcatccctgcgcagccaccaaagg
gtgcacacagggcaacggcctttcagctgtggcatctgtggcaaaagcttctcccaacgg
tcagcacttatcccccacgcccgcagccacgcccgtgaaaagccctttaagtgccctgag
tgcggcaagcgctttggccagagttctgttctagccatccatgctcgcacccatctgcca
ggccgcacatacagctgtcccgactgtggcaaaaccttcaaccgctcctctacactcatt
cagcaccagcgctcccacacaggcgagaggccataccgctgcgctgtgtgtggcaagggc
ttctgtcgttcctccacgctgctgcagcaccatcgcgtgcatagtggggagcgaccttat
aagtgtgatgactgtggaaaggccttctcgcaaagctccgacctcatccgccaccagcgg
acccacgcggcgggccgccgctaa

DBGET integrated database retrieval system