KEGG   Rattus norvegicus (rat): 102554388Help
Entry
102554388         CDS       T01003                                 

Definition
(RefSeq) olfactory receptor 143-like
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    102554388
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    102554388
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    102554388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 Glycoprotein_G 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 102554388
NCBI-ProteinID: XP_006242896
RGD: 7594678
Ensembl: ENSRNOG00000048510
UniProt: M0RDN2
Position
8q22
AA seq 313 aa AA seqDB search
MKQMIMENDSSVSEFILMGLADQPELQLPLFFLFLMNYTATVMGNLSLMSIIFLNSNLHT
PVYFFIFNLSFIDFCYSFVFTPKMLMSFVLEKNTISFRGCMTQLFFFCFFVNSESSVLTA
MAYDRYVAICQPLMYKVVMSPGICFMLMFGSYLMGFAGAMAHTGCMIRLSFCDSNIINHY
MCDIFPLLQLSCSSIYVNELVSFVVVGTVITLSSLIILISYGMILYNIIHISSGKGWSKA
MGTCGSHIITVSLFYGSGLLAYVKPSSAETVGQGKIFSVFYTFLVSMLNPLIYSLRNKDV
KIAMKRTMKRLNK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaatgattatggaaaatgattcttctgtgtctgagtttattcttatgggactg
gcagaccaacctgagctccagctcccactattttttctcttcttgatgaactacacagcc
actgtgatgggtaacttgagcttaatgagtatcattttcttgaattcaaaccttcacact
cccgtgtactttttcatcttcaatctgtccttcattgatttttgttattcatttgttttt
acccccaaaatgctaatgagttttgttttagagaaaaacaccatctccttcagaggatgc
atgactcagctgttcttcttctgcttttttgtgaactctgagagttctgtgctgacagcc
atggcctatgatcgctatgtggccatctgtcagccacttatgtacaaggttgttatgtca
cctggaatatgttttatgctgatgtttgggtcttacttgatggggtttgctggggccatg
gctcacacagggtgtatgatcaggctcagcttttgtgactctaacatcatcaaccactac
atgtgtgacatcttccctctcctccagctctcctgcagtagcatctacgtaaatgaactt
gtgagctttgtagtggtgggtacggttatcactttatctagcctaattatcttaatctct
tatggtatgatcctttacaatatcattcatatatcatcaggtaagggttggtccaaagct
atgggaacctgtgggtcccacatcataactgttagtctcttttatggatctgggctgctt
gcttatgtcaagccatcttctgctgagactgtgggccaggggaaaattttctcagtgttt
tatacattcttggtttccatgctgaatcctcttatttacagcctcaggaacaaggatgtc
aagattgccatgaagagaaccatgaagagactcaacaaatga

DBGET integrated database retrieval system