KEGG   Rattus norvegicus (rat): 102554393
Entry
102554393         CDS       T01003                                 

Gene name
Adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    102554393 (Adamts13)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     102554393 (Adamts13)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   102554393 (Adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_3 Reprolysin_4 Reprolysin_5 TSP1_spondin Reprolysin_2 TSP1_CCN Peptidase_M10 ADAM_spacer1 Sensor
Other DBs
NCBI-GeneID: 102554393
NCBI-ProteinID: XP_006233941
RGD: 1311594
Ensembl: ENSRNOG00000005780
UniProt: D4A0T9
Position
3
AA seq 1482 aa
MDEKFPGGTVGSQATWDGTCRDREPLTSLSSCRPGVSSQNESQSPGLPSGHRLPVLRMSQ
LCLWLPCQPFLAASIRGILTGAIFILGCWGLSDFQKSFLQDLEPKDLSSSFSRHTAPLTG
HPSSHLQRLRQRRTSEDILHLELLVAVGPDVYQAHQEDTERYVLTNLNIGSELLRNPSLG
AQLQVHLVKLIILSDSENTPNITTNITSSLMSVCEWSQTINPHDDRDPSHADLIIYITRF
DLELPDGNQQVRGVTQQGGACSPSWSCLITEDTGFDLGVTIAHEIGHSFGLDHDGAPGSG
STCEARGHVMASDGAVPAGGALEWSTCSQRQLQHLLSTGQMHCLWDPPGLQSGLTWHQLV
AQPGLFYSADDQCRVAFGAGAVACTFSREGLDVCQALSCHTDPLDQSSCSRLLVPLLDGT
ECGVEKWCSKARCRSLAELAPVAVVHGHWSSWGPHSPCSRSCGGGVITRRRWCNNPRPAF
GGRACVGEDLQAKMCNTQACEKTQLEFMSEQCAQTDRHPLQLSQGSASFYHWDAAVQYSQ
GDTLCRHMCWAVGESFIVSRGDSFLDGTRCVPNGPREDGTVSLCLLGSCRTFGCDGKMDS
QQVWDACQVCGGDNSTCTSQNGSFTAGRAREYVTFLIVTPNMTSAHVINHRPLFTHLAVR
IQDHYIVSGKSSMSPNVTYPSLLEDYRVEYRVTLTEDQLPRLEEIHIRGPVRDDIEIQVY
RRYGGEYGGLTHPDITFTYFQRKQQAAWVWAAKRGPCSVSCGAGLRWVTYSCQDQAQNKW
VRNAQCQGSPQPPAWQEPCVSAPCPPHWVADDFGPCSVSCGGGLRERSLRCVEAHNGFLK
TLPPAPCRAVAQQPAGEVENCNSQPCPTGWEVSDPSPCVSSACEPGLESGSGTCVPRVGD
SEKPAMAGPCRPDDMSPVPEPCVRTTCSPGSGPVDTMSLGEEASSPVGSGKPSSQAEHVW
TPLVGLCSISCGKGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWET
RVLAPCPVTCGGGRVPLAIHCVQLDHGRPVSVPHSKCWPAPRPGSFEDCSPEPCPARWKV
LPLGPCSASCGLGTATQMVACVQLDQGHDNEVDETFCKALVRPPASVPCLIADCAYRWHI
STWTECSVSCGDGIQRRHGTCLGPQAQVPVPANFCQHLPKPVTVRGCWAGPCAGQKISSS
LPHKEATLPSQTLAAVTAASLQWSQPQAQAHSLFPDSQSLGLQETLEEPGACGRQYLEPT
GTIDMRGQGQLDCVVAIGRPLGEVVTLQILESSLKCRAGELLLLWGKFTWRKMCWKMSGR
TFSTKANTVVVRQHRVLPGGGVLLLYRSQPAPGTFYKECDRQLFGPRGEITSPSLSPDGR
KAGTCRVFVSVAPQARIAIRALASDMGTASEGTSANYVSIRDIHGLKTTTFWGQQVLYWE
SEGSEAELEFSHGFLEAHASFQGQYWTIPPRTPEQVNSVALS
NT seq 4449 nt   +upstreamnt  +downstreamnt
atggatgagaaattcccaggaggtacagtgggaagccaggcaacttgggacggtacttgc
agagatagagaaccacttacctctctctccagctgcaggccaggcgtttcgtctcaaaac
gaatcccagtcaccagggctcccgtccggccatcggctgcctgttctaaggatgagccag
ctttgcttatggttgccgtgccagccttttcttgctgccagtatcagaggaatcctcacg
ggcgccatcttcattctgggctgctgggggctctctgatttccagaagagttttcttcaa
gatctggagcccaaggacttatcttcctccttcagccgccatactgctccactcacaggc
catccttcctctcacctccagagactgagacagaggaggacttcggaggacattctgcac
ctagaactcctggtagctgtgggccccgatgtttaccaggctcaccaggaggacacagag
cgctacgtgctcaccaacctcaatatcgggtcagaactgttgagaaacccgtccctaggg
gctcagctccaagtgcacctggtgaagctgatcattctctcggactcagagaatactccg
aatatcacgaccaacatcacctcatccttgatgagtgtctgcgagtggagccagacgatc
aatccccatgatgacagggacccaagtcatgctgacctgatcatctatataaccaggttt
gacctggagctgccggatggtaaccagcaggttcggggagtcacccaacagggtggtgcc
tgctctccttcctggagttgccttatcactgaggacactggcttcgatctgggggtcacc
attgcccacgagattggacacagctttgggctggaccatgatggtgctccaggcagtggc
agcacctgcgaggcccgtggccatgtgatggcatctgacggcgcagtgcctgctggaggg
gccctggagtggtccacctgcagccaaaggcagctgcagcacctgctcagcacagggcaa
atgcactgcctctgggacccgcccgggctgcagtcaggactcacatggcaccagctggtg
gcacagcctggcctcttctacagtgcagatgaccagtgccgtgtggctttcggcgccggg
gctgtcgcctgcaccttctccagggagggtctggatgtatgccaggctctgtcctgtcac
acagaccccctggaccaaagcagctgcagccgcctccttgttcctctcctggacgggaca
gaatgtggtgtagagaagtggtgctctaaggctcgctgtcgctccctagctgagctggct
cctgtggctgtggtacatggacactggtctagctggggcccccacagtccttgctctcga
tcctgtggaggaggtgtgatcaccaggagacggtggtgcaacaaccccaggcctgcattt
gggggacgtgcatgtgtgggcgaggacctccaggctaagatgtgcaacacgcaggcttgt
gagaagactcagctggagttcatgtcagagcagtgtgcccagacagacagacatccactg
caactttcccaaggcagtgcctccttctaccactgggatgctgctgtgcagtatagtcaa
ggggatactctgtgcagacacatgtgctgggctgttggagaaagtttcattgtcagccgt
ggggacagtttcctcgatgggacccgttgtgtgccaaatggtcctcgggaggatgggacc
gtgagcctctgtttgttgggtagctgcaggacctttggctgtgatggcaagatggactcc
cagcaggtttgggatgcgtgccaggtgtgtggaggagacaacagcacctgcacttcccaa
aatggctctttcacagctgggagagccagagagtatgtcacgttcctgatagtcactccc
aacatgaccagcgcacacgtcatcaaccacaggcctctcttcacacacttggcggtgagg
atccaggaccactacattgtgtcagggaagagcagcatgtcgcctaacgtcacgtaccct
tcccttctggaggactaccgcgtggagtacagagtaactctcactgaggaccagctgccc
cgcttagaggagattcacatccggggacctgtccgggatgacattgagatccaggtgtac
agacgatatggaggagaatatgggggtcttacacacccagacatcacctttacctacttc
caacggaagcagcaggcagcctgggtatgggccgctaagcgtgggccctgctcagtgagc
tgtggggcagggctgcgctgggtgacctacagctgccaggatcaagctcaaaacaagtgg
gtgaggaacgcccagtgccaagggagcccgcagccacctgcatggcaggagccttgtgtc
tctgccccgtgccctccacactgggtagctgacgactttggcccatgcagcgtgtcttgt
ggcggaggccttcgggagcggtcactgcgctgtgtagaggcccacaatggcttcttaaag
acgttgccgccagccccatgcagagcagtagcccagcagccagcaggagaggtagaaaac
tgcaactcccagccctgccccactggatgggaggtgtcagaccctagcccttgcgtgtca
tctgcgtgtgaacccggtctggagtcagggagtgggacatgtgtgcccagggtgggtgac
tcagagaagccagcgatggcaggcccctgccgcccggatgacatgtcacctgtgccggag
ccctgcgttaggaccacatgttctccaggctcgggtccggtggacaccatgtctctggga
gaggaggcttcatccccagtgggcagtggcaagccaagctctcaggctgaacatgtgtgg
actcctctggtggggctgtgctccatttcttgtgggaaaggtctgaaggagctgtatttc
ctgtgcatggattctgtcctcaagatgcctgtccaggaagagctatgtggcttggccagt
aagcccccaagccggtgggaggtctgcagggctcgcccatgtcctgctcggtgggagact
cgagtcttggcaccgtgtccggtgacctgtggcggggggcgagtgccgctggccattcat
tgtgtgcagctggaccacgggcgccctgtgtctgtacctcactccaagtgctggccagca
cctaggccaggctccttcgaggactgcagccctgagccttgtcctgctagatggaaagtc
ctgccccttggcccgtgctcagccagctgtggccttggcactgccacacaaatggtggcc
tgcgtgcagcttgaccaaggccatgacaatgaggtggatgaaactttctgtaaggctctg
gtgcggccccccgccagtgttccctgcctcattgctgactgtgcataccggtggcacatc
agcacctggacagagtgctccgtctcctgtggggatggcatccagcgccggcatggcacc
tgcctcggaccccaggctcaagtgcctgtgccagccaacttctgccagcacctgcccaag
ccagtgactgtgagaggctgctgggctggaccctgtgcagggcagaagatctccagctcg
ctgcctcacaaggaagctactcttcccagccagaccctggctgcggttactgctgcctct
ctgcaatggtcccagccccaagcccaggcccacagccttttcccagactcccagtctctg
gggctccaggaaaccctggaagagcctggagcctgtggaaggcaatacctggagcccaca
ggaaccattgacatgcgaggtcaaggacagctagactgtgtggtagccatcgggagacct
ctaggtgaagtggtgaccctccaaatcctcgagagctccctcaagtgcagagcaggggag
ctgctgctgctctggggtaagttcacatggcggaagatgtgctggaagatgtctggcagg
actttcagcacaaaagccaacacggtggtggtgaggcagcatcgtgtgctgccgggaggt
ggagtgctgctactgtaccggagccaacctgccccagggaccttctacaaagaatgtgac
aggcagctctttggacctcggggtgaaatcacgagtccctcactgagcccagacgggagg
aaggcaggaacctgcagggtctttgtcagtgtggccccacaggcccgaattgccatccgt
gccctggccagtgacatgggcactgcttctgaggggaccagtgccaactatgtctcgatc
agggatatccacggtctgaagactacaacattttgggggcagcaggtgctctactgggag
tccgaaggcagtgaggctgaactggagtttagccatggcttcctggaggcgcatgccagt
ttccagggccagtattggaccatcccaccgaggacaccggaacaggtcaacagcgtggct
ctgtcctag

DBGET integrated database retrieval system