KEGG   Rattus norvegicus (rat): 102554884
Entry
102554884         CDS       T01003                                 

Gene name
Rcor1
Definition
(RefSeq) REST corepressor 1
  KO
K11829  REST corepressor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    102554884 (Rcor1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    102554884 (Rcor1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    BRAF-HDAC complex
     102554884 (Rcor1)
SSDB
Motif
Pfam: Myb_DNA-binding ELM2 Myb_DNA-bind_7 Myb_DNA-bind_6 Homeobox_KN
Other DBs
NCBI-GeneID: 102554884
NCBI-ProteinID: NP_001292392
RGD: 7505493
Ensembl: ENSRNOG00000008067
UniProt: B5DEY2
Position
6
AA seq 382 aa
MRVGPQYQAAVPDFDPAKLARRSQERDNLGMLVWSPNQSLSEAKLDEYIAIAKEKHGYNM
EQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDK
SIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEPNGSNPVDIDIDPNRESK
KEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDME
LVSIKRQIQNMKQTNSALKEKLAGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRD
FQAISDVIGNKSVVQVKNFFVNYRRRFSIDEVLQEWEAEHGKEEANGPTNQKPAKSPESS
VKIQEEEDEAASVLDVRYASAS
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgcgggtgggaccccagtaccaagccgcggtgcccgacttcgaccctgccaaactggca
aggcgcagtcaagaacgagacaatcttggcatgttggtctggtcacctaatcagagtctt
tctgaagcaaaactggacgagtacatcgctattgccaaagagaagcacgggtacaacatg
gagcaggctcttgggatgctcttttggcataagcataacatcgagaaatcactggccgac
ttgcccaacttcaccccctttcccgatgagtggacggtagaagacaaagtcttatttgag
caagcctttagtttccatgggaagacttttcatagaatccagcaaatgcttcccgataaa
tccatagccagcttggtgaagttttactactcttggaagaaaaccagaactaaaaccagt
gtgatggaccgtcacgctcggaaacaaaagcgtgagcgagaagaaagtgaggacgaactg
gaagaaccaaacggcagtaatcccgtcgacatcgacatcgacccaaacagagaaagcaaa
aaggaggtaccccctactgagacagttcctcaggtcaaaaaagaaaaacatagcacacaa
gctaaaaatagagcaaaaaggaaacctccaaaaggcatgtttctttctcaagaagatgtg
gaggctgtgtctgctaatgctactgctgcgaccacggtgctgagacagctggacatggag
ctggtctccatcaaacgacagattcagaacatgaagcagacgaacagcgctcttaaagaa
aagctcgctggtgggatagagccttatcgacttccggaggttattcagaaatgtaacgca
cgctggacaacagaagagcagcttctcgccgtacaagccattaggaaatacgggcgagat
tttcaggcaatctcagatgtgatcgggaacaagtcagttgttcaggtgaaaaactttttt
gtgaattaccggcgccgcttcagcatagatgaagttttacaggagtgggaagccgagcat
ggcaaagaggaggccaacgggcccaccaaccagaagcctgccaagtccccggaaagctct
gtcaagatccaggaggaggaagatgaggctgcttctgtcctcgacgtaagatatgcatct
gcctcatga

DBGET integrated database retrieval system