KEGG   Rattus norvegicus (rat): 102556337
Entry
102556337         CDS       T01003                                 

Definition
(RefSeq) mitochondrial fission factor-like
  KO
K22076  mitochondrial fission factor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    102556337
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102556337
SSDB
Motif
Pfam: Miff
Other DBs
NCBI-GeneID: 102556337
NCBI-ProteinID: XP_008765547
RGD: 7706142
Ensembl: ENSRNOG00000015428
UniProt: Q4KM98
Position
9q35
AA seq 218 aa
MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQDGVPNASVIMQVPERIVVT
GNNEDISFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPPTPQSEEIRA
VGRLKRERSMSENAVRQNGQLVRNDSMYGISSLDAAVEGASEDMSVVDAASLRRQIIKLN
RRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR
NT seq 657 nt   +upstreamnt  +downstreamnt
atggcagaaattagtcgaattcagtacgaaatggaatacactgaaggtattagtcagcga
atgagggtcccggaaaaattaaaagtagcaccaccaaatgctgacctggaacaagggttc
caagatggagttccaaatgccagtgtgataatgcaagtcccagagaggatcgtggttaca
ggaaataatgaagacatttccttttcaagaccagcagatcttgaccttatccagtccact
ccctttaaacctctggcgctgaaaacacctccacgtgtgctcacactgagtgagagaccg
ctagatttcctggatttagaaagaccacctccaactcctcaaagcgaagagatccgagca
gttggcaggctaaaaagagaacgctctatgagtgaaaatgctgttcgccagaatggacag
ttggtcagaaacgattccatgtatggcatttcaagcctagatgcagctgttgaaggagcg
tcagaggacatgtctgtggtagatgcggcttcattgagacgtcagataatcaaattaaac
agacgtctacaacttctggaagaggagaataaagagcgtgctaaaagagaaatggtcatg
tattcaattactgtagcgttctggctgcttaacagctggctctggtttcgacgctag

DBGET integrated database retrieval system