KEGG   Rattus norvegicus (rat): 103689931Help
Entry
103689931         CDS       T01003                                 

Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein A/B
  KO
K13044  heterogeneous nuclear ribonucleoprotein A/B/D
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    103689931
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    103689931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 CBFNT RRM_7 Nup35_RRM_2 RRM_3 NID DUF2462 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 103689931
NCBI-ProteinID: XP_006246407
RGD: 9343685
Ensembl: ENSRNOG00000046272
UniProt: Q9QX81
Position
10q22
AA seq 332 aa AA seqDB search
MSDAAEEQPMETTGATENGHEAAPEGEAPVEPSPGAAAPATPAGSGGGTTAAPSGNQNGA
EGDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGF
ILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFG
QFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKEVY
QQQQYGSGGRGNRNRGNRGSGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGY
YGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacgcggctgaggagcagcccatggagacgacgggcgccaccgagaacggacac
gaggccgcccccgaaggcgaggccccggtcgagcctagccctggggcagcggcccccgcg
actccggcggggtctgggggcgggaccacggccgccccgagcgggaaccagaacggcgcc
gaaggcgaccagatcaacgccagcaagaacgaggaggacgcgggaaaaatgttcgttggt
ggtctgagctgggataccagcaaaaaagatctaaaggattattttactaagtttggagag
gtcgttgactgtacaataaaaatggatccgaacactggtcgatcaagagggtttgggttt
attctcttcaaagattcttctagtgtggagaaggtcttagatcagaaggagcacagactg
gatggtcgtgtcattgaccctaaaaaggctatggctatgaagaaggaccctgtgaagaaa
atctttgtgggaggtctaaaccctgaagccacagaggaaaagatcagagaatactttggc
cagtttggggagattgaggccattgaacttccaatagatcccaagttgaacaaaagacgg
ggttttgtttttattacatttaaagaggaagaccctgtgaagaaagttctggagaaaaaa
ttccatactgtcagtggtagcaagtgtgaaatcaaggttgcccagcccaaagaggtgtac
cagcaacagcagtatggctctgggggccgaggaaatcgcaatcgagggaaccgaggcagt
ggtggaggtcagagtcagagttggaatcagggctacggcaactactggaaccagggctac
ggctaccagcagggctacgggccgggctatggcggctacgactactcgccctatggctat
tacggctacggccccggctacgactacagtcagggtagtacaaattacgggaagagccag
cgacgtggtggtcatcagaataactacaagccatactga

DBGET integrated database retrieval system