KEGG   Rattus norvegicus (rat): 103689983
Entry
103689983         CDS       T01003                                 

Definition
(RefSeq) hypoxanthine-guanine phosphoribosyltransferase
  KO
K00760  hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103689983
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    103689983
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     103689983
SSDB
Motif
Pfam: Pribosyltran UPRTase PRTase_2
Other DBs
NCBI-GeneID: 103689983
NCBI-ProteinID: XP_008771881
RGD: 9163824
Ensembl: ENSRNOG00000031367
UniProt: P27605
Position
Xq37
AA seq 218 aa
MSTLSPSVVISDDEPGYDLDLFCIPNHYAEDLEKVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKQYSPKMVKVASLLVKRTSRSVGYRPDFVG
FEIPDKFVVGYALDYNEHFRDLNHVCVISESGKAKYKA
NT seq 657 nt   +upstreamnt  +downstreamnt
atgtcgaccctcagtcccagcgtcgtgattagtgatgatgaaccaggttatgacctagat
ttattttgcatacctaatcattatgctgaagatttggaaaaggtgtttattcctcatgga
ctgattatggacaggactgaaagacttgctcgagatgtcatgaaggagatgggaggccat
cacattgtggccctctgtgtgctgaaggggggctataagttctttgctgacctgctggat
tacattaaagcgctgaatagaaatagtgataggtccattcctatgactgtagattttatc
agactgaagagctactgtaatgaccagtcaacgggggacataaaagttattggtggagat
gatctctcaactttaactggaaagaacgtcttgattgttgaagatataattgacactggt
aaaacaatgcagactttgctttccttggtcaagcagtacagccccaaaatggttaaggtt
gcaagcttgctggtgaaaaggacctctcgaagtgttggatacaggccagactttgttgga
tttgaaattccagacaagtttgttgttggatatgcccttgactataatgagcacttcagg
gatttgaatcatgtttgtgtcatcagcgaaagtggaaaagccaagtacaaagcctaa

DBGET integrated database retrieval system