KEGG   Rattus norvegicus (rat): 103689989
Entry
103689989         CDS       T01003                                 

Definition
(RefSeq) prolactin-3D4
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 103689989
NCBI-ProteinID: XP_008769896
RGD: 9320638
Ensembl: ENSRNOG00000016792
UniProt: P34207
Position
17p11
AA seq 223 aa
MQLTLTLSGSSMQLLLLVSNLLLWENMASKPTVLVSTEDLYHRLVEQSHNTFIKAADVYR
EFDINFAKRSWMKDRILPLCHTASIHVPENREEVHEIKTEDLLRSIINISVSWKEPLKHF
VSAVTDLPGASASMRKKAVDMKDKNLIILEGLQKIFNRTQTKVEENENFDYPAWSGLKDL
QSSDEDTHLFAIYNLCRCFKSDIHKIDTYLKVLRCRVVFKNEC
NT seq 672 nt   +upstreamnt  +downstreamnt
atgcagctaactttgactctttcaggctccagtatgcaactgttgctgctggtgtcaaac
ctgctcttgtgggaaaacatggcctccaaaccaactgtgcttgtgtccactgaagacctg
tatcatcgtttggttgaacagtctcataatacatttatcaaggctgcagatgtataccgt
gaatttgatataaattttgccaagagaagttggatgaaagacaggatacttcccctgtgt
cacactgcttccatccacgttccagagaatcgagaggaagttcatgaaattaaaactgaa
gaccttctgagatcaatcatcaatatttcagtttcctggaaagaacctctcaaacacttt
gtgtctgcagtgactgatcttccgggagcttctgctagtatgaggaaaaaagctgttgat
atgaaggacaaaaatcttataattctggagggacttcagaaaatattcaacaggactcag
actaaggttgaagaaaatgaaaattttgactaccctgcctggtctggactcaaagacttg
cagtcatctgatgaagacactcatctttttgccatttataatctgtgccgctgctttaaa
agtgacatccataagattgacacttatctcaaagtcttgaggtgccgagttgtctttaag
aatgagtgttga

DBGET integrated database retrieval system