KEGG   Rattus norvegicus (rat): 103690024
Entry
103690024         CDS       T01003                                 

Definition
(RefSeq) peroxisomal targeting signal 1 receptor-like
  KO
K13342  peroxin-5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103690024
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    103690024
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    103690024
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_11 TPR_8 TPR_17 TPR_14 TPR_16 TPR_19 TPR_12 TPR_7 TPR_9 TPR_10 TPR_20 ANAPC3 DUF1641
Other DBs
NCBI-GeneID: 103690024
NCBI-ProteinID: XP_008761499
RGD: 9150037
Ensembl: ENSRNOG00000010407
UniProt: Q2M2R8 A0A0A0MP84
Position
4q42
AA seq 641 aa
MAMRELVESECGGANPLMKLATHFTQDKALRQEGLRPGPWPPGASAAETVSKPLGVGTED
ELVAEFLQDQNATLVSRAPQTFKMDDLLAEMQEIEQSNFRQAPQRAPGVADLALSENWAQ
EFLAAGDAVDVAQDYNETDWSQEFIAEVTDPLSVSPARWAEEYLEQSEEKLWLGDPEGTS
TTDRWYDEYHPEEDLQHTASDFVSKVDDPKLANSEFLKFVRQIGEGQVSLESAAGSGRAQ
AEQWAAEFIQQQGTSEAWVDQFTRPGNKLAALQVEFERAKSAIESDVDFWDKLQAELEEM
AKRDAEAHPWLSDYDDLTSASYDKGYQFEEENPLRDHPQPFEEGLRRLEEGDLPNAVLLF
EAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNRTALMALAVSFTNESL
QRQACETLRDWLRYSPAYAHLVAPGEEGASGAGLGPSKRVLGSLLSDSLFLEVKELFLAA
VRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQS
EEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGA
MSENIWSTLRLALSMLGQSDAYGAADARDLPALLTMFGLPQ
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggcaatgcgggagctggtggagagcgaatgtgggggtgccaacccgctgatgaagctg
gccacccacttcacccaggacaaggcccttcggcaggagggactgaggcctggcccctgg
cctccaggagcctcagcggcggaaacggtttccaagcctttgggagtaggcactgaagat
gagttggtggcagaattcctgcaggaccagaatgcaactcttgtatcccgagcccctcag
accttcaagatggatgacctcttggcggagatgcaggagattgaacagtcaaactttcgc
caggctcctcagagagcccctggtgtggcagacttggctttgtctgagaattgggcccag
gagtttcttgccgctggagatgctgtggatgtagctcaggattataacgagaccgactgg
tcccaagaattcatcgccgaagtcacggaccctctgtctgtgtccccagcccgatgggct
gaggagtatctggaacagtctgaggagaagctgtggttgggagatccagaaggaacctct
accactgaccgatggtacgatgaataccatcctgaggaggatctgcagcacacagccagt
gactttgtgtccaaggtggacgaccccaaattggctaactctgagttcctgaaattcgtg
cggcagattggcgaggggcaggtgtccctggagtccgctgcagggtcgggccgagctcag
gcagaacagtgggcagcagagtttatacagcagcagggcacatcggaggcctgggttgat
cagttcacaagaccaggaaacaaactggctgctcttcaggtggaatttgaacgagccaag
tcagctatagagtcagacgtcgatttctgggacaagttgcaggcagagttggaggagatg
gcaaaacgggatgctgaggcgcacccctggctttctgactatgacgacctcacgtctgct
tcctatgacaagggctaccagtttgaggaggagaatcccttgcgtgaccaccctcagcct
tttgaagaagggctgcgtcgacttgaggagggagacctgcccaatgctgtgctgctcttc
gaggctgcggtgcagcaggatcctaagcacatggaggcctggcagtacctgggcaccact
caggctgagaacgagcaagagctcttggccatcagtgccctgcgcaggtgtctggagcta
aagccagataaccggacagcactgatggcgctggctgtaagcttcaccaatgagtccctg
cagcggcaagcctgtgagacgctgcgggactggctgcgctactcaccggcctacgctcac
ctggtggctcctggtgaagaaggggctagtggggcaggactgggtcccagcaagcgcgtc
ttgggatctctgttgtctgactccctgtttcttgaagtaaaagaactcttcctggcagct
gtgcgtctggaccctacatccattgaccctgacgtgcagtgtggcctgggagtcctcttc
aacctgagtggggagtacgacaaggctgtggactgtttcacggctgccctcagtgtccgc
cccaatgactatttgctgtggaacaagcttggggccaccctggccaacgggaaccagagt
gaagaagcagtggctgcttaccgcagagcccttgaactacagcctgggtacatccgctcc
cgctacaacctaggcatcagctgcatcaaccttggggctcaccgtgaggccgtggaacac
tttctggaggccctgaacatgcagaggaagagccggggccctcggggtgaggggggcgcc
atgtctgagaacatctggagtactctgcggttggcattgtccatgctaggccagagtgat
gcctatggggcagccgatgctcgggacctgcctgcccttctaactatgtttggcctgccc
cagtga

DBGET integrated database retrieval system