KEGG   Rattus norvegicus (rat): 103690116Help
Entry
103690116         CDS       T01003                                 

Definition
(RefSeq) osteomodulin
  KO
K08124  osteomodulin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    103690116
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    103690116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRRNT LRR_5 LRR_9 LRR_6
Motif
Other DBs
NCBI-GeneID: 103690116
NCBI-ProteinID: XP_008769742
RGD: 9400356
Ensembl: ENSRNOG00000046658
UniProt: G3V7Y2
Position
17p14
AA seq 423 aa AA seqDB search
MGFLSPIYVLFFCFGVRVYGQYEAYQWDEDYEQEPSEDYEPEFQFHQNIEYGAPFYQNIL
GCAKECFCPTNFPTSMYCDNRKLKTIPDIPMHIQQLNLQFNDIEAVTADSFINATHLKEI
NLSHNKIKSQKIDYGVFAKLSNLQQLHLDHNNLEEFPFPLPKSLERLLLGYNEISTLPTH
AMDGLVNVTMLDLCYNHLSDSTLKGKILSKLEKLMQLNLCNNRLESMPPGLPSSLMYLSL
ENNSISSIPEDYFQKLPKLHALRISHNKLEDIPYDIFNLSNLIELNVGHNKLKQAFYIPR
NLEHLYLQNNEIQSINVTMMCPSLDPLHHHHLTYLRVDQNKLKEPISSYIFFCFPRIHSI
YYGEQRSTNGETIQLKTQVFRRYQDEEEEEEDDSQDHTLEGQEETEEHFNSHYYEMQAWQ
NTI
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgggctttttaagtccaatatatgtcctcttcttctgttttggagttagagtatacggc
caatatgaagcttaccagtgggatgaagattatgagcaagagccaagtgaggattatgag
ccagaattccagtttcaccaaaatatcgaatatggagctcccttttatcagaatatttta
ggttgtgctaaggaatgcttctgtccaactaactttccaacatcaatgtactgtgacaac
cgcaaactcaagactatcccagatattccaatgcacattcagcaactcaaccttcagttc
aatgatattgaggctgtgactgcagattcattcatcaatgcaactcatcttaaagaaatt
aaccttagccacaacaaaattaaatctcaaaagattgattatggtgtgtttgctaaactt
tcaaatctacagcaacttcatctagatcacaataacttagaagaatttccatttcctctt
cctaaatctctggaaagactccttcttggttataatgaaatctctacacttccaacacat
gccatggatgggctggtaaatgtcactatgcttgacctctgctataaccatctctctgac
tccacgttaaaaggaaagattctttccaaactggaaaagctcatgcagcttaacctgtgc
aataacaggttagagtcaatgccccctgggttgccgtcatcacttatgtatctatcttta
gaaaataattcaatttcatctataccagaggattactttcagaaacttccaaaacttcat
gctctaagaatatcacacaacaaacttgaagacattccatatgacatctttaatctttcc
aatcttatagaactcaatgttggacataacaaactgaagcaagcattctacattccaagg
aatttggaacatctatacctacaaaataatgaaatacaaagcatcaatgtgacaatgatg
tgtccttctcttgatccattacaccatcaccatttaacataccttcgtgtggaccaaaat
aagctgaaggaaccaataagttcatatatcttcttctgcttccctcggatacacagtatt
tattatggtgagcagaggagcactaatggtgaaacaatacaactgaagacccaagttttc
aggcgctatcaagatgaggaagaggaagaggaagacgacagtcaggaccacactcttgag
ggtcaagaagaaacagaagagcactttaattctcattactatgaaatgcaagcatggcaa
aatactatatag

DBGET integrated database retrieval system