KEGG   Rattus norvegicus (rat): 103690123Help
Entry
103690123         CDS       T01003                                 

Gene name
Hoxa2, Hoxa-2, Hoxa11, RATHOX111A, hox-1.11
Definition
(RefSeq) homeo box A2
  KO
K09302  homeobox protein HoxA/B2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    103690123 (Hoxa2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    103690123 (Hoxa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain
Motif
Other DBs
NCBI-GeneID: 103690123
NCBI-ProteinID: NP_036713
RGD: 2813
Ensembl: ENSRNOG00000049993 ENSRNOG00000059600
UniProt: P31246 G3V6R6
Position
4q24
AA seq 372 aa AA seqDB search
MNYEFEREIGFINSQPSLAECLTSFPPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLN
PGSHPRQSAGAGGRPKSSPAGSRGSPVPARALQPPEYPWMKEKKAAKKTALPPAAASTGP
ACLGHKESLEIADGSGGGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTE
RQVKVWFQNRRMKHKRQTQCKENQNSEGKFKNLEDSDKVEEDEEEKSLFEQALSVSGALL
EREGYTFQQNALSQQQAPNGHNGDSQTFPVSPLTSNEKNLKHFQHQSPTVPNCLSTMGQN
CGAGLNNDSPEALEVPSLQDFNVFSTDSCLQLSDALSPSLPGSLDSPVDISADSFDFFTD
TLTTIDLQHLNY
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgaatttgagcgagagattggttttatcaatagccagccgtcgctcgctgag
tgcctgacatcttttccccctgtcgctgatacatttcaaagttcatcaatcaagacctcg
acgctttcacactcgacactgattcctcctccttttgagcagaccattcccagcctgaac
ccgggcagtcaccctcgccaaagcgctggcgctggcggccgccccaagtcgagccccgcg
ggcagtcgcggcagcccggtgcccgcccgcgccctgcagccgcctgagtacccctggatg
aaggagaagaaggcggccaagaaaaccgcgctgccgcccgccgccgcctccacgggccct
gcctgcctcggccacaaagaatccctggaaatagccgatggcagcggtgggggatccagg
cgtctgagaactgcttacaccaacactcagcttttggaactggaaaaggaatttcatttc
aacaagtacctctgcagaccccggagggtggaaatcgccgcgctgctggatttgaccgag
agacaagtgaaagtgtggtttcagaaccggaggatgaagcataagaggcaaacccagtgc
aaggagaaccaaaacagcgaagggaaatttaaaaacctggaggattcggacaaagtggag
gaagacgaggaagagaagtcactctttgagcaagccctcagtgtctccggggcccttctg
gagagggaaggttacacttttcagcaaaacgcgctctctcaacagcaggctcccaatgga
cacaatggcgactcccaaactttcccagtttcgcctttaaccagcaatgagaaaaatttg
aaacattttcagcaccagtcacccactgttcctaactgcttgtcaacaatgggccagaac
tgtggagctggcctaaacaatgacagtcccgaggccctcgaggtcccctctttgcaggac
tttaatgttttctccacagattcctgcctgcagctttcagacgcactgtcgcccagtttg
ccaggctccctggacagtcctgtagatatttcagctgacagctttgacttttttacagac
acactcaccacaatcgacctacagcatctgaattactaa

DBGET integrated database retrieval system