KEGG   Rattus norvegicus (rat): 103690164
Entry
103690164         CDS       T01003                                 

Definition
(RefSeq) 5-phosphohydroxy-L-lysine phospho-lyase
  KO
K18202  5-phosphonooxy-L-lysine phospho-lyase [EC:4.2.3.134]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103690164
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.134  5-phosphooxy-L-lysine phospho-lyase
     103690164
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-GeneID: 103690164
NCBI-ProteinID: XP_008765956
RGD: 9104895
Ensembl: ENSRNOG00000047933
UniProt: A0A0G2KB65
Position
10q22
AA seq 460 aa
MAADRRAKAATLDLRRRLLSSSCRLFFPENPVKIIRGQGQYLYDEQGREYLDCINNVAHV
GHCHPTVVQAAHEQNLVLNTNSRYLHDNIVDYAQRLSETLPEKLSVFYFLNSGSEANDLA
LRLARQYTGHQDVVVLDHAYHGHLSSLIDISPYKFRNLDGQKEWVHVAPLPDTYRGPYRE
DHPDPAGAYASEVKHVISSAQKKGRKIAAFFAESLPSVSGQIIPPAGYFSQVAEHIRRAG
GLFVADEIQVGFGRVGKHFWAFQLEGEDFVPDIVTMGKSIGNGHPVACLATTQAVSRAFE
ATGVEYFNTFGGNPVSCAVGLAVLDVLKTEQLQAHATNVGSFLMEHLSQQKAKHPIIGDV
RGTGLFIGVDLIKDETLRTPATEEAEYLVSRLKENYILLSTDGPGRNILKFKPPMCFSLD
NAQHVVAKLDDILTDMEEKVRSCETLRIKHPPEDTHPTQI
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggccgcggaccggcgcgccaaggccgccactctggacctgagacgtcggctgctcagc
tcttcctgcagactcttttttcctgagaatcctgttaagattatccgaggccaagggcag
tacttgtatgatgagcaagggcgagagtacctggactgcatcaacaatgtggctcatgtc
gggcactgccaccctaccgtggtccaagctgcacatgaacagaacctggtgctcaacacc
aacagccgatatctacatgacaacatcgtggactatgcccagaggctgtcagagaccctg
ccagagaagctttctgtgttttatttcctgaattctgggtcagaagccaacgacctggcc
ttgagactagctcgccagtacacaggacaccaggatgtggtggtattagaccatgcttat
catggtcacctgagctcattgatcgacatcagtccctacaagttccggaatctggatggc
cagaaggaatgggtccatgtggctccgctcccagacacctaccggggaccttaccgggag
gaccaccccgatccagcaggggcctatgccagtgaggtgaagcatgtcatcagcagtgca
cagaagaagggcaggaagattgcagccttcttcgccgagtctctgcctagtgtgagtgga
cagatcattccccctgctggatacttctcccaggtggcggagcacatacgcagagccgga
gggctctttgtggctgatgagatccaggttggttttggccgagtaggcaaacacttttgg
gccttccagctggagggagaagactttgtccccgacattgtcaccatgggcaagtccatc
ggcaatggtcatcctgttgcctgcctggccactacccaagctgtgtcaagggcatttgaa
gctaccggtgtagaatacttcaacacgtttggtggcaatcctgtgtcctgtgctgtgggg
ctagcagtcctggatgtcttgaaaacagaacagctccaggctcatgccactaatgtgggc
agcttccttatggagcacctcagccagcagaaagccaaacatcctatcattggagatgtc
aggggcactgggctcttcattggtgtggatctgatcaaggatgagactctgaggacacca
gcaactgaagaggcagagtatttggtctccaggctaaaggaaaactacattttactgagc
actgacggccctgggaggaatatcctgaagttcaagcctccaatgtgcttcagccttgat
aacgcacagcatgtggttgcaaagctggatgacattctaacagacatggaagaaaaagta
cgaagttgtgaaacactgaggatcaaacaccctccagaagatactcatcctactcaaata
taa

DBGET integrated database retrieval system