KEGG   Rattus norvegicus (rat): 103690255Help
Entry
103690255         CDS       T01003                                 

Definition
(RefSeq) olfactory receptor-like protein OLF3
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    103690255
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    103690255
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    103690255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 103690255
NCBI-ProteinID: XP_008761177
RGD: 9076846
Ensembl: ENSRNOG00000053006
UniProt: D4ADM1
Position
4q24
AA seq 311 aa AA seqDB search
MGKKNQTWVSEFLLLGLSTDWGTQVSLFVLFLAMYLLTVLGNLLIIILIKLDSKLHTPMY
FFLSILSFVDICYTNSTVPQMLVHFLSARKSIPFHSCVLQLYISLAMGSTEFFLLGAMAY
DRYVAVCHPLHYMVIMHGGLCLRLASACLTAGLSNSLMQTLMIFQLPFCRTVINHFACEM
LAVLRLSCVDISLNKVMVAISGFLVIMLPCILVLFSYAHIVAAILRIRSSQGRRKAFGTC
ASHLTVVSMCFGTAIFTYMRPVGRSSAGQEKMVALFYAVVTPMLNPLIYSLRNNDVIGAL
KRTLEKLKENK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaaaaaccagacatgggtgagtgaattcttgttgctggggttgtcaactgac
tgggggactcaggtctccttgtttgtactgttcctggccatgtacttgctgactgtcctg
gggaacctactcatcatcatcctcatcaagctggacagcaagctccatacgcccatgtac
ttcttcctcagcatcctgtcatttgtggacatctgttacaccaacagcactgtcccccag
atgctcgtccatttcctgtcagccaggaagtccatcccatttcatagttgtgtgctgcag
ctgtatatctccctagcaatgggtagcacagagttcttcttgctaggtgccatggcttat
gaccgctacgtggcagtgtgccaccctctgcactacatggtcattatgcatggagggctg
tgcctaaggttggcttcagcctgtctgactgctggtctctcaaattcactaatgcagaca
ctcatgatctttcaattacccttctgtcgtacggtcatcaatcacttcgcctgtgagatg
ctggctgtactgaggctgagttgtgtggacatctccctcaacaaggtcatggtagccatc
tcaggatttctggtgatcatgcttccttgtattctggtgctattttcctatgctcatatt
gttgctgccattctgcgtattcgctcttcccagggacgacgaaaagcctttgggacttgt
gcctcccacctcacagtggtttctatgtgctttggaacagccatctttacatacatgagg
cctgtgggcagatcctcagcaggacaagagaagatggttgctctcttctatgctgttgtg
acgccaatgctcaatcccctcatctacagcttgagaaacaatgatgtgattggggctttg
aaaagaactttggagaaacttaaggaaaacaaatag

DBGET integrated database retrieval system