KEGG   Rattus norvegicus (rat): 103690308Help
Entry
103690308         CDS       T01003                                 

Definition
(RefSeq) olfactory receptor 14J1-like
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    103690308
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    103690308
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    103690308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 103690308
NCBI-ProteinID: XP_008756426
RGD: 9081777
UniProt: D3Z8A6
Position
Un
AA seq 312 aa AA seqDB search
MIVKNITTMSGFLLKGFSDNCELQILHALLFLVTYLLGSTGNFIIITITTLDSQLQSPMY
YFLKHLSILDLSSLSVTVPQYVDSSLARSGYILYGQCMLQIFFFTGFAWGEVAILTVMSY
DRYVAVCLPLHYEVIMCPRKCRWAVTAVWLSSGIPGTLYVATIFSIKFCRAKIIHQFFCD
VPQLLKLSCSNDHLVIMGVADFLSAMAFACFIGIVISYVHIFSTVLRMPSAESRSKVFST
CLPHLFVFSLFLSTGSCAYLNPTSDSPTALEFLFSAFYTVLPPTLNPLIYSLRNETIKSV
VRKLLFSTKFAG
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgaaaaatataaccacaatgagtggatttctcctcaaggggttctctgacaac
tgtgagctgcagatcttacatgctttgctcttcttggtgacatacctattgggctcaaca
ggtaacttcatcattatcaccatcacaacactggactctcagctccagtctccaatgtat
tactttctgaagcacctttccattctggacctctcatccctctctgtcacagttcctcag
tatgttgacagttccctggcacgaagtggctacattttatatggacagtgcatgctgcag
atttttttcttcacaggttttgcctggggtgaagtggccattctcacagtgatgtcatat
gatcgttatgtagctgtttgccttccactgcactatgaggtcatcatgtgtcccagaaag
tgtaggtgggctgtgacagctgtgtggctaagcagcggcattcccggaaccctgtacgta
gcaaccatattctctatcaaattttgtagggccaaaataattcaccaattcttctgtgat
gtccctcagttgctcaagctctcctgctctaatgatcaccttgtaataatgggagtggct
gatttcctgtcggcaatggcctttgcctgctttattgggattgtcatctcctatgtccac
atattctccacggttctcaggatgccctctgctgagagcaggtctaaggtcttctctact
tgcctgccccacctttttgttttctcattgtttctttctacaggctcctgtgcataccta
aaccctacctcagactctccaactgctttagagttcttattctctgcattttacacagta
ctacctccaactctcaaccctcttatttatagtctgagaaatgagaccataaagagtgtt
gtaagaaagttactgtttagtacaaaatttgctggttaa

DBGET integrated database retrieval system