KEGG   Rattus norvegicus (rat): 103690375Help
Entry
103690375         CDS       T01003                                 

Definition
(RefSeq) olfactory receptor 4C15-like
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    103690375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    103690375
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    103690375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 103690375
NCBI-ProteinID: XP_008760243
RGD: 9409894
Ensembl: ENSRNOG00000061898
UniProt: D3ZLL9
Position
3q24
AA seq 311 aa AA seqDB search
MLNQSFVMEFVFLGLSQNPNLQKLIFIICLIVYIATIGSNMMIVVTIVYSPTLLGCPMYF
FLAFLSLLDASFSSAMTPKMIVDSLYKRKTISFEGCMIQLFVEHFFGGAEMILLTAMAYD
RYVAICKPLHYSSIMTRKLCGTLVGMAWAGGFLHSTVQIIFTLQLPFCGPNVINHFMCDL
FPLLELACTDTHIFSLFVVANSGLICIIVFVLLLISYAFILMSLRSQSSEGRWKALSTCG
SHVAVVVLFFVPCIFIYARPHSAFSFDKMVALFYTMLSPLLNPIIYTFRNKDMKNAIRKL
WKKLVIVPDER
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaccagagttttgtaatggaatttgtctttctggggctttctcagaatccaaat
cttcaaaaactaatatttattatatgtctaattgtctacattgcaactattgggagcaat
atgatgattgtggtgaccattgtctatagccctacactgctgggatgtcccatgtatttc
ttcctggctttcttgtctttactggatgcaagcttttcttctgccatgacacccaagatg
attgtagattctctctacaagagaaaaaccatctcctttgaaggatgcatgatacaactt
tttgttgaacacttctttggtggggccgagatgattcttctgacagccatggcctatgac
cgttatgtggccatttgtaaacccttacactactcttccatcatgaccaggaagctctgt
ggcactctggtagggatggcctgggcaggaggattcttacattctactgtacaaattatc
ttcactttgcagctacctttttgtggacccaatgtcatcaatcacttcatgtgtgactta
tttccattactggaacttgcctgcactgacactcacatctttagtcttttcgtggtggcc
aacagtgggttgatctgtatcatagtctttgttttgttgcttatctcctatgcttttatc
ttgatgtctctgagatcacagagttctgaaggacgatggaaagctctgtctacttgtggg
tcccatgttgctgttgtggtcttgttctttgtcccatgtatatttatatatgcaaggcct
cacagtgccttctcctttgacaaaatggtggcattattttacaccatgctttctccgttg
cttaatcctatcatttacacttttaggaataaggacatgaaaaatgccataaggaaattg
tggaagaaattggtaattgttccagatgaaaggtaa

DBGET integrated database retrieval system