KEGG   Rattus norvegicus (rat): 103690878
Entry
103690878         CDS       T01003                                 

Definition
(RefSeq) syntaxin-3-like
  KO
K08486  syntaxin 1B/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    103690878
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    103690878
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    103690878
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    103690878
Membrane trafficking [BR:rno04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    103690878
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   103690878
  Exosomal proteins of other body fluids (saliva and urine)
   103690878
SSDB
Motif
Pfam: Syntaxin SNARE DUF547 GIT_CC
Other DBs
NCBI-GeneID: 103690878
NCBI-ProteinID: XP_008771591
RGD: 9098358
Ensembl: ENSRNOG00000031283
UniProt: D3ZUH2
Position
X
AA seq 297 aa
MKDRLEELKNHINHGTVSLELDDTLMFDNHAFEKTETNTIEEFLQEVAELSLALTELEGL
SQLIDKKQQGVLCCTTEESVFKEKNELNIIKASFASQARLIQPQLSTIQHELATDCKYWR
AEHRIRQSQLSFLLSHYRGIISHHYVCETQNMVRLKEKMVRQADLAGVKLQEEDLEKLVA
NPVPPQIVGRDLDVLKAKQGLALAEVRNQQLLELECQISELRTIFFQVETFISGQQELLD
SIEYNILRTQDYVEQSNETVKKALKYKRQSRFLMVISTVAGLCACCTCLSCITGPLH
NT seq 894 nt   +upstreamnt  +downstreamnt
atgaaggacagattagaggaactgaagaaccacattaaccacggaacagtctctttggag
ttggatgacaccttgatgtttgacaaccatgcttttgaaaagactgaaacaaataccata
gaagagtttttacaggaagtggctgagctgtctctggcactgacagagttagaaggacta
tctcagttaatagacaagaagcagcaaggtgtcctgtgttgtaccacagaggagagtgtg
ttcaaggagaagaacgaactgaacatcataaaggcctcctttgctagccaagcccgactc
atccagcctcagctgagcaccatccagcatgagttggccacagattgtaagtactggcgg
gctgagcaccgcattcgtcagagtcagctctcttttctccttagtcactaccgtggcatc
atcagccaccactatgtctgtgagactcagaatatggtcaggctgaaggagaagatggtg
agacaggctgacctagctggggtgaagctccaggaagaggacctggaaaaactggtggct
aaccctgtgcctcctcaaattgtcggtcgtgatctagatgttttgaaggctaagcagggt
ctggctttggctgaagtacgtaaccagcagctgctggaactggagtgccagatcagcgaa
ttgcgtaccatcttcttccaagtagaaacattcatttcaggacagcaagagttgctggat
agcattgagtacaacattttgcgcacccaggactatgttgaacagtcaaatgagacagtg
aagaaagcccttaaatacaagcgtcaatcacgatttttgatggtgatatcaactgttgca
ggtctttgtgcttgttgtacttgcttgtcctgtatcactgggcctttacactga

KEGG   Rattus norvegicus (rat): 116470
Entry
116470            CDS       T01003                                 

Gene name
Stx1a
Definition
(RefSeq) syntaxin-1A
  KO
K04560  syntaxin 1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
rno04721  Synaptic vesicle cycle
rno04911  Insulin secretion
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05031  Amphetamine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    116470 (Stx1a)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    116470 (Stx1a)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    116470 (Stx1a)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    116470 (Stx1a)
   05022 Pathways of neurodegeneration - multiple diseases
    116470 (Stx1a)
  09165 Substance dependence
   05031 Amphetamine addiction
    116470 (Stx1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    116470 (Stx1a)
Membrane trafficking [BR:rno04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    116470 (Stx1a)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 AAA_13 Ferritin GNVR PspA_IM30 Prominin Syntaxin-6_N Laminin_II FAD_binding_1 FlgN LMBR1 DUF1910 CorA Lzipper-MIP1 DUF148 SIMPL Lipoprotein_2 YtxH
Other DBs
NCBI-GeneID: 116470
NCBI-ProteinID: NP_446240
RGD: 69430
Ensembl: ENSRNOG00000029165
UniProt: P32851 A0A1E1ERK2
Structure
PDB: 

Position
12
AA seq 288 aa
MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSA
ILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQH
STLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASG
IIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHA
VDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaaggaccgaacccaggagctccgcacggccaaggacagcgatgacgacgatgatgtc
actgtcactgtggaccgagaccgcttcatggatgagttctttgaacaggtggaagagatc
cggggctttattgacaagattgctgaaaacgtggaggaggtgaagaggaaacacagcgcc
atcctggcctccccgaaccccgatgagaagaccaaggaggaactggaggagctcatgtcg
gacattaagaagacagcgaacaaagttcgctccaagctaaagagcatcgagcagagcatc
gagcaggaggaaggtctgaaccgctcgtcggcggacctgaggatccggaagacgcagcat
tccacgctgtcccgaaagtttgtggaggtcatgtccgagtacaacgccactcagtcagac
taccgagaacgctgcaaagggcgcatccagaggcagctggagatcactggccggaccacg
accagtgaggagttggaagacatgctggagagtgggaatcccgccatctttgcctctggg
atcatcatggactccagcatctcgaagcaggccctcagtgagatcgagaccaggcacagt
gagatcatcaagttggagaacagcatccgggagctacacgatatgttcatggacatggcc
atgctggtggagagccagggggagatgattgacaggatcgagtacaatgtggaacacgct
gtggactacgtggagagggccgtgtctgacaccaagaaggccgtcaagtaccagagcaag
gcacgcaggaagaagatcatgatcatcatttgctgtgtgattctgggcatcatcatcgcc
tccaccatcgggggcatctttggatag

KEGG   Rattus norvegicus (rat): 24923
Entry
24923             CDS       T01003                                 

Gene name
Stx1b
Definition
(RefSeq) syntaxin-1B
  KO
K08486  syntaxin 1B/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    24923 (Stx1b)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    24923 (Stx1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24923 (Stx1b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24923 (Stx1b)
Membrane trafficking [BR:rno04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    24923 (Stx1b)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   24923 (Stx1b)
  Exosomal proteins of other body fluids (saliva and urine)
   24923 (Stx1b)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 AAA_13 Lzipper-MIP1 GNVR FAD_binding_1 Baculo_PEP_C Acyl-CoA_dh_2 TolA_bind_tri Sec34
Other DBs
NCBI-GeneID: 24923
NCBI-ProteinID: NP_036832
RGD: 3784
Ensembl: ENSRNOG00000019193
UniProt: P61265
Position
1
AA seq 288 aa
MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAI
LAAPNPDEKTKQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHS
TLSRKFVEVMTEYNATQSKYRDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDI
KMDSQMTKQALNEIETRHNEIIKLETSIRELHDMFVDMAMLVESQGEMIDRIEYNVEHSV
DYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLASSIGGTLGL
NT seq 867 nt   +upstreamnt  +downstreamnt
atgaaggatcggactcaggagctgcggagtgcaaaagacagtgacgatgaagaggaagtg
gttcatgtggatcgagaccactttatggatgagttctttgagcaggtggaagagatccga
ggctgcatcgagaaactgtccgaggatgtggagcaagtgaagaaacagcacagtgccatt
cttgctgcccccaaccccgatgagaagactaaacaggagctggaggacctcacggcagac
atcaaaaagacggcaaacaaggtccggtccaagttgaaagcgatcgagcagagcattgag
caggaagaggggttgaatcgttcttctgcagacctgcgtatccgtaagacccagcactcc
acactctcacggaagttcgtggaggtaatgaccgaatataatgcaactcagtctaagtac
cgggaccgctgcaaggaccgtatccagaggcagctggagatcactggcaggactactacc
aacgaagagctggaagacatgttggaaagcgggaagctggccatcttcacggacgacatc
aaaatggactcgcagatgacaaagcaagccctgaatgagatagagacaaggcacaatgag
atcatcaaactggaaaccagcatccgagagctgcacgacatgtttgtggacatggccatg
ctcgtggagagccagggtgagatgatcgaccgaattgagtacaatgtggaacattctgtg
gactacgtggagcgagccgtgtccgacaccaagaaagctgtgaaatatcagagcaaggcc
aggaggaagaaaattatgatcatcatttgctgtgtggtgctgggggtggtcttggcgtca
tctattggggggacactgggcttgtag

KEGG   Rattus norvegicus (rat): 25130
Entry
25130             CDS       T01003                                 

Gene name
Stx2
Definition
(RefSeq) syntaxin-2
  KO
K08486  syntaxin 1B/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    25130 (Stx2)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    25130 (Stx2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    25130 (Stx2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    25130 (Stx2)
Membrane trafficking [BR:rno04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    25130 (Stx2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   25130 (Stx2)
  Exosomal proteins of other body fluids (saliva and urine)
   25130 (Stx2)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 DUF3671 ETRAMP Syntaxin-6_N DUF6161 ApoLp-III CbiA Tlp DUF2205 CwsA DUF2116 DUF16 Med28
Other DBs
NCBI-GeneID: 25130
NCBI-ProteinID: NP_036880
RGD: 2558
Ensembl: ENSRNOG00000000936
UniProt: P50279
Position
12
AA seq 290 aa
MRDRLPDLTACRKSDDGDNAVIITVEKDHFMDAFFHQVEEIRSSIARIAQHVEDVKKNHS
IILSAPNPEGKIKEELEDLNKEIKKTANRIRGKLKAIEQSCDQDENGNRTSVDLRIRRTQ
HSVLSRKFVDVMTEYNEAQILFRERSKGRIQRQLEITGRTTTDEELEEMLESGKPSIFIS
DIISDSQITRQALNEIESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMVNNIERNVVN
SVDYVEHAKEETKKAIKYQSKARRKKWIIAAVVVAVIAVLALIIGLTVGK
NT seq 873 nt   +upstreamnt  +downstreamnt
atgcgggaccggctgccggacctcacggcgtgtaggaaaagcgacgatggagacaatgct
gtcatcatcacggtggagaaggaccacttcatggatgccttcttccatcaggtggaggag
attcgaagcagcatagccaggattgctcagcacgtggaggatgtgaagaagaaccacagc
atcatcctctctgccccaaacccagaaggaaaaataaaagaagagctggaggacctgaac
aaagagatcaagaaaactgctaacaggatccggggcaagctgaaggctattgagcagagt
tgtgatcaggacgagaatgggaaccgaacttcagtggatctgcggatacgaaggacccag
cactcagtgctgtcacggaagtttgtggacgtcatgacagaatacaatgaagcacagatc
ctgtttcgggagcgaagcaaaggccgaatccagcgccagctagagatcactgggaggacc
accactgacgaggagctggaggagatgctggagagcgggaagccgtccatcttcatctcg
gacattatatcagattcacagattactaggcaagctctcaatgagatcgagtcacgccac
aaagacatcatgaagctggagaccagcatccgagagctgcacgagatgttcatggatatg
gccatgtttgtcgagactcagggtgaaatggtcaacaacattgagagaaacgtggtgaac
tccgtagattacgtggagcacgccaaggaagagactaagaaagccatcaaataccagagc
aaggccagacggaaaaagtggataattgctgctgtggtggtggctgtcattgctgtcctg
gctctaatcattggcttgacggttggcaaatga

KEGG   Rattus norvegicus (rat): 81802
Entry
81802             CDS       T01003                                 

Gene name
Stx3
Definition
(RefSeq) syntaxin-3
  KO
K08486  syntaxin 1B/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
rno04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    81802 (Stx3)
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    81802 (Stx3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81802 (Stx3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    81802 (Stx3)
Membrane trafficking [BR:rno04131]
 SNARE
  Syntaxin (Qa)
   Stx-PM
    81802 (Stx3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   81802 (Stx3)
  Exosomal proteins of other body fluids (saliva and urine)
   81802 (Stx3)
SSDB
Motif
Pfam: Syntaxin SNARE Syntaxin_2 Branch GyrB_insert SIMPL DUF5984 LPD11 DUF3040 T2SSF Podoplanin
Other DBs
NCBI-GeneID: 81802
NCBI-ProteinID: NP_112386
RGD: 621005
Ensembl: ENSRNOG00000021013
UniProt: Q08849 B4F7E6
Position
1
AA seq 289 aa
MKDRLEQLKAKQLTQDDDTDEVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLY
SIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEVRSSADLRIRKSQH
SVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSG
IIDSQISKQALSEIEGRHKDIVRLESSIKELHDMFMDIAMLVENQGEMLDNIELNVMHTV
DHVEKARDETKRAMKYQGQARKKLIIIIVIVVVLLGILALIIGLSVGLK
NT seq 870 nt   +upstreamnt  +downstreamnt
atgaaggaccgactggagcagctgaaggccaagcagctgacgcaggatgatgacacggac
gaggttgagattgctattgataatacagcgttcatggatgagttcttttctgagattgag
gaaacgaggctcaacatcgacaagatctcagagcatgtggaggaagctaagaaactctac
agtatcattctctctgcaccgattccagagccaaaaaccaaagacgaccttgaacagctc
acaactgagatcaagaaaagggccaacaacgtccggaacaaactgaagagcatggagaag
catattgaggaagacgaggtccggtcatcagcagaccttcggatacgaaagtcccagcac
tccgtcctctcccggaagtttgtggaggtgatgacaaagtacaatgaggcacaggtggac
ttccgtgaacgcagcaaagggcgcatccaacggcagcttgaaattactggcaagaaaaca
acagatgaggagctggaagaaatgttggagagtggcaacccagccatcttcacttctggg
atcattgactcccagatttccaagcaagccctcagcgagattgagggtcggcacaaggac
atcgtgaggctggagagcagcatcaaggagctccatgacatgtttatggacatcgccatg
ctggtggagaatcagggtgagatgttagataacatagagttgaatgtcatgcacacggtg
gaccatgtggagaaggcacgggatgaaactaaaagagccatgaagtatcagggtcaggct
cgaaagaaattgataattatcattgtgatagtagttgtgttgctgggcattttagcgttg
attattggattgtccgttgggctgaaataa

DBGET integrated database retrieval system