KEGG   Rattus norvegicus (rat): 103691922
Entry
103691922         CDS       T01003                                 

Definition
(RefSeq) 28S ribosomal protein L42, mitochondrial
  KO
K17423  large subunit ribosomal protein L42
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    103691922
Ribosome [BR:rno03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    103691922
SSDB
Motif
Pfam: MRP-S32
Other DBs
NCBI-GeneID: 103691922
NCBI-ProteinID: XP_008760533
RGD: 9333559
UniProt: P0C2B9
Position
13q13
AA seq 141 aa
MTAAVKWAVSHRTIWRHLFPIQNGAISSACHKSTYSSLPDDYNCKVELALTSDGRTIVCY
HPSVDVPYEHTKPIPHPDLLHNNEETHEQILRTKLEGNHKHLEQGPMIEQLSKVFFTTKH
RWYPHGQYHRCRKKLNPPKDR
NT seq 426 nt   +upstreamnt  +downstreamnt
atgacggcagcagtgaaatgggcggtatcacacagaactatctggaggcatttatttcca
atccaaaatggagccatatctagtgcttgtcacaaatctacgtattcttcccttccagac
gactacaattgcaaggtagagctggctttgacatctgacggcaggacaatagtgtgctac
cacccttccgtggatgtcccctacgaacacaccaaacctatccctcatccagatcttctg
cataataacgaggaaacacacgagcagatactgagaaccaagttagaaggaaatcacaag
catcttgagcaagggcccatgatagaacaactcagcaaagtgttcttcaccacgaagcat
cgctggtacccacacggacagtatcacagatgccgtaagaaactgaaccctcccaaagac
aggtga

DBGET integrated database retrieval system