KEGG   Rattus norvegicus (rat): 103692019
Entry
103692019         CDS       T01003                                 

Definition
(RefSeq) olfactory receptor 8B3-like
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    103692019
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    103692019
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    103692019
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 103692019
NCBI-ProteinID: XP_008760886
RGD: 9287839
Ensembl: ENSRNOG00000049725
UniProt: D3ZU37
Position
4q11
AA seq 310 aa
MASANVSLVTEFILVGLTNQPDLQIPLFFVFLIMYIVTALGNLCLIILIVLNSHLHTPMY
FFLFNLSFIDLCYSTVFTPKMLMNFILSKNAISYMGCLTKLYFFCFFVISECYVLTSMAY
DRFVAISNPLLYTVAMSPKLCLNLMLGTYLMAFSGAMAHTGCMLRLTFCDANTINHYFCD
ILPVMQLSCTSTYVNELVVFIVVGINIIVPSITIFISYGFILSSIFHIKSNEGRSKAFST
CSSHIIAVCLFFGSGAFMYLKPSSSSSMDQGKTSSVFYTNVVPMMNPLIYSLRNKDVKMA
LRKTLSRRKF
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcctctgcaaatgtctctttggtgactgaattcattctggtaggtttaacaaaccag
cctgatctccaaattcccctgttctttgtgtttctaataatgtatattgttactgcattg
ggaaatttgtgtctaataattcttattgtactaaattcacatctccacactcctatgtac
tttttcctctttaacttgtccttcatagatctctgctattctactgtgttcactccaaaa
atgctgatgaactttatattgagcaagaatgcaatttcttacatgggatgcttgaccaag
ctatatttcttttgtttttttgtcatttctgagtgttatgtgttgacttcaatggcttat
gatcgctttgtggccatctctaatccacttttgtacactgttgccatgtcccctaaattg
tgtttgaaccttatgcttggcacatatttaatggcattttctggtgccatggctcacaca
ggatgtatgctaagactgaccttctgtgatgctaacaccatcaaccattacttctgtgac
atcctccctgtgatgcagctctcatgcaccagcacctatgtcaatgaacttgtagttttc
attgtggtaggcatcaacatcattgtgcccagcatcaccatttttatctcttatggtttc
attctgtccagcattttccacatcaaatctaatgaaggcaggtccaaggccttcagcacc
tgcagttcccatataattgcagtttgtctgttctttggatcaggtgcatttatgtatctc
aaaccatcttcttcttcatcgatggatcaaggaaaaacctcttctgtattttataccaat
gtggttcctatgatgaatcccttaatctacagtttaaggaacaaagatgtaaaaatggcc
ctgagaaaaactctgagtagacggaaattttga

DBGET integrated database retrieval system