KEGG   Rattus norvegicus (rat): 103692126
Entry
103692126         CDS       T01003                                 

Gene name
NEWGENE_1587253
Definition
(RefSeq) homeobox A7
  KO
K09307  homeobox protein HoxA/B7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    103692126 (NEWGENE_1587253)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    103692126 (NEWGENE_1587253)
SSDB
Motif
Pfam: Homeodomain Ribosomal_60s
Other DBs
NCBI-GeneID: 103692126
NCBI-ProteinID: XP_008761163
RGD: 9471641
Ensembl: ENSRNOG00000049858
UniProt: M0R7P7
Position
4q24
AA seq 229 aa
MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGPGAGAFASNVPGLYNVNSP
LYQNPFASSYGLGADAYNLPCASYDQNIPGLCSDLAKGACDKADEGVLHGPAEASFRIYP
WMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNR
RMKWKKEHKDESQAPTAVPEDAVPSVSTAADKADEEEEEEEEEEEEEEE
NT seq 690 nt   +upstreamnt  +downstreamnt
atgagttcttcgtattatgtgaacgcgctttttagcaaatatacggcgggggcttctctc
ttccaaaatgccgagccgacttcttgctcctttgcacccaactcgcagagaagcggctac
gggccgggcgccggcgccttcgcctccaacgtgccgggcttatacaatgtcaacagcccc
ctctatcagaaccccttcgcctccagctacggtctgggagccgacgcctacaacctgccc
tgcgcctcctacgaccaaaacatccccgggctctgcagtgacctcgccaaaggcgcctgc
gacaaggcggacgagggcgtgctgcacggcccggccgaggccagtttccgcatctacccc
tggatgcgcagttcaggacccgataggaagcggggacgccagacctacactcgctaccag
acgctggagctggagaaggaattccacttcaaccgctacctgacgcggcgccgccgcatc
gagatcgctcacgcgctctgcctcaccgagcgccagatcaagatctggttccagaatcgg
cgcatgaagtggaagaaagagcataaagatgagagccaggctcccactgcagttccagaa
gacgcggtgccctccgtttccacggctgctgacaaggccgatgaggaagaggaggaggaa
gaggaggaggaagaggaggaagaggagtaa

DBGET integrated database retrieval system