KEGG   Rattus norvegicus (rat): 103693323Help
Entry
103693323         CDS       T01003                                 

Gene name
Col23a1
Definition
(RefSeq) collagen alpha-1(XXIII) chain
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen
Motif
Other DBs
NCBI-GeneID: 103693323
NCBI-ProteinID: XP_017453116
RGD: 9310824
Ensembl: ENSRNOG00000003349
UniProt: Q810Y4
Position
10q22
AA seq 532 aa AA seqDB search
MGAGERAAGGGGTQDPGAGCGARALGALCLLLSVGSATACLLLGAQAAALHGRVAALEQE
RELLRRAGPSGALAAWAETHLERLLREKLDGVAKLRTVREAPSECICPPGPPGRRGKPGR
RGDPGPPGQSGRDGYPGPLGLDGKPGLPGPKGEKGAPGDFGPRGAQGQDGAAGPPGPPGP
PGARGPPGDTGKDGPRGAQGPEGPRGESGQDGEMGPMGPPGPKGEPGTPGKKGDDGIPSQ
PGLPGPPGPKGEPGDVGPQGETGVDGAPGLKGEPGHPGTDGAIGPRGPPGLKGEQGDTVV
IDYDGRILDALKGPPGPQGAPGPPGIPGAKGELGLPGAPGIDGEKGPKGPKGDPGEPGPA
GPKGETGEMGLSGLPGADGPKGEKGESASDHLQESLAQIIVEPGPPGPPGPPGPMGLQGI
QGPKGLDGAKGEKGASGERGPHGLPGPVGPPGLIGLPGTKGEKGRPGEPGLDGFPGPRGE
KGDRSERGEKGERGVPGRKGVKGQKGEPGPPGLDQPCPVGPDGLPVPGCWHK
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgggcgagcgcgcggcgggcgggggaggcacgcaggaccccggcgcgggctgc
ggggcgcgggcgctgggcgcgctgtgcctgctgctgtcggtgggctctgcgaccgcctgt
ctcctgctgggcgcccaagcggccgccttgcatggccgagtggcggcgctggagcaggag
cgcgaactgttgcggcgtgcggggccgtccggagccctggcggcctgggccgaaacgcac
ctggagcgcctgctacgggagaagttggatggagtcgccaagctcaggacagttcgagaa
gccccctctgagtgcatctgtccccctggtccccctggacggcgtggcaagccgggacga
agaggcgacccaggccctccggggcaatcaggacgagatggctacccgggacctctaggt
ctggacggcaagccaggacttccaggccccaaaggggaaaagggtgcaccaggagacttt
ggcccacggggagcccaagggcaagatggagctgcaggaccacctgggcctcctgggcca
cctggggcccggggccctcctggtgacactgggaaagatggtccccgaggagctcaaggc
ccagagggtcccagaggagagtctggacaagatggcgaaatgggccccatgggacctcca
ggacccaagggagaacctggcactcctggaaagaagggggatgatgggatacccagccag
ccaggactccctggacccccagggcccaagggtgagccaggagatgtggggccccaagga
gagactggagtagacggtgcccctggactgaagggggagcccggtcacccaggcacggat
ggagccatagggccccggggtcccccaggcctcaagggagaacaaggtgacacggtggta
atcgactatgatggcaggatcttagatgccctgaagggtcctcccggaccacagggagct
cctgggccaccagggatccctggagccaagggtgaacttggattgcctggtgctccagga
attgatggagagaagggtcccaaaggaccaaaaggagacccaggagagcctggaccagct
gggcccaaaggggaaacaggagagatgggcctgtcaggtcttccgggtgccgatggtccc
aagggagaaaagggagagtcagcatctgaccatctacaggagagcctggcccagatcata
gtggagccagggccccccggtcctcctgggccccccggccccatgggccttcaggggatc
cagggtcccaagggcctggatggagccaagggagaaaagggtgcatcgggtgagagaggc
cctcacggtctgcctggaccagttggcccaccaggccttattgggttgcccggaaccaaa
ggagagaagggccgacccggagagccaggactcgacggtttccctggacccaggggagag
aaaggcgaccgaagtgaacgaggagagaagggggagcgaggagttcctggtcggaaagga
gtgaaaggccagaagggagagccaggcccaccaggccttgaccagccatgccctgtgggc
cccgacgggttgcctgtgcctggttgctggcataagtga

DBGET integrated database retrieval system