KEGG   Rattus norvegicus (rat): 103693341Help
Entry
103693341         CDS       T01003                                 

Gene name
Tnfrsf13b
Definition
(RefSeq) TNF receptor superfamily member 13B
  KO
K05150  tumor necrosis factor receptor superfamily member 13B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04672  Intestinal immune network for IgA production
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103693341 (Tnfrsf13b)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    103693341 (Tnfrsf13b)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    103693341 (Tnfrsf13b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    103693341 (Tnfrsf13b)
   04090 CD molecules [BR:rno04090]
    103693341 (Tnfrsf13b)
Cytokine receptors [BR:rno04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103693341 (Tnfrsf13b)
CD molecules [BR:rno04090]
 Proteins
  103693341 (Tnfrsf13b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TACI-CRD2 BCMA-Tall_bind BaffR-Tall_bind
Motif
Other DBs
NCBI-GeneID: 103693341
NCBI-ProteinID: NP_001292920
RGD: 1595998
Ensembl: ENSRNOG00000002304
Position
10q22
AA seq 245 aa AA seqDB search
MALCPKKQYWDSLKRTCVSCVLTCSQRSQRTCTDFCKFINCRKEQGKYYDHLLGTCVSCD
STCTQHPQQCAQFCEKRPRSQVNLQSELRRPETREVEARPDNLGRYQGSEHSPGLRMNSD
QLTLYCTLGVCLCAIFCCFLVALASFLRRRGEPLPSQPAGQRGSQANSPHGPMTEARNEV
AMPPQPVETCSFCFPERSSPTQESAPRSLGIHGFAGTAAPQPCMRASVSGLAVVRTPTGD
ERPGA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggcactctgccccaaaaagcagtactgggactccttgaagagaacctgtgtctcctgc
gtgttaacctgcagccagaggagccagcgcacctgtacagacttctgcaaattcatcaac
tgcagaaaagagcaaggcaagtactatgaccatctcctggggacctgtgtcagctgtgac
tccacctgcacacagcaccctcagcagtgtgcacagttctgtgagaaaaggcccagaagc
caggtgaacctccagtccgagctcaggagaccagagacccgggaggtggaagccaggccg
gataacttaggaaggtaccaggggtcagagcacagtccaggattgaggatgaacagtgac
cagctgactctctactgcaccctgggggtctgcctctgcgccatcttctgttgtttcttg
gtggccttggcctccttcctcaggcgtagaggagagccacttcccagccagcctgccggg
cagcgtgggtcacaagcaaactctccccacgggcccatgacagaggctcgcaatgaggtg
gccatgccaccccagcctgtcgaaacgtgtagcttttgcttcccggagcgcagttcgccc
actcaggagagtgcaccacgctcactcgggattcacggctttgcgggcactgccgccccg
cagccctgtatgcgcgcatctgtcagcggcctggctgttgtacgcacgcccaccggggac
gagcgtccaggagcttga

DBGET integrated database retrieval system