KEGG   Rattus norvegicus (rat): 103694226
Entry
103694226         CDS       T01003                                 

Gene name
RGD1559715
Definition
(RefSeq) interferon-inducible GTPase 1-like
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: IIGP MMR_HSR1 Dynamin_N ABC_tran RsgA_GTPase AAA_16 AAA_29 KAP_NTPase Roc FeoB_N Sigma54_activat PRK AAA_22 RNA_helicase AAA_23 AAA_30
Other DBs
NCBI-GeneID: 103694226
NCBI-ProteinID: XP_008770418
RGD: 9112732
Ensembl: ENSRNOG00000046839
UniProt: J7PDL5
Position
18q12.1
AA seq 418 aa
MGQLFSLTTNEQGEDLPSSFAKYFKKFKTGHKIISEEIITSVELSMTKGNIQMANSAISE
AFREIDSTPLNVAVTGESGAGKSSFINALRGIGHEEEGAAEIGVVETTMWRHKYQHPSMP
NVVIWDLPGIGTTNFPPKTYLEKMKFYEYDFFIIISATRFKKNDIDLAKAISMMKKDFYF
VRTKVDSDLRNEENTKPRSFDREKVLQNIRLNCVKHFKENGMDEPPIFLISNIDLSDYDF
PILMDKLISDLPVYKRHTFMLSLPNITDSTIEMKRQCLKQRIWLEAFAADLLRILPSLTF
LLDSDLETLKKCLKFYRTVFGVDDAALQSLAKDWQMPLVELEAMMKSPIVFKPTDEETIH
ERLSRYYHDYCSANGHLLTNNRDLREISYLKYYFLDIVTEDAKTLLKEICVRNKLVSN
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgggtcaactgttctctttgacaactaatgaacagggtgaagatttaccctccagcttt
gcaaaatattttaagaaatttaagacaggacacaaaatcatttctgaggaaatcatcact
tcagttgaattaagcatgacaaaagggaacattcaaatggcaaactctgcaatcagtgag
gcattcagagaaattgatagtacaccgctcaatgttgctgtcaccggggagtctggagca
ggaaagtccagtttcatcaatgccctgagaggcattgggcatgaagaggaaggtgcagct
gaaattggggtggtggagacaaccatgtggagacacaaataccaacaccccagtatgcct
aatgtggtcatttgggacctgcctgggattggaaccacaaattttccaccaaaaacatat
ctagaaaagatgaaattctatgaatatgacttcttcattattatttcagccacccgcttt
aagaaaaatgatatagacctcgccaaagcaatcagtatgatgaagaaggatttctacttt
gtgagaaccaaggtggactctgacttacgaaatgaagagaacaccaaaccacgatccttt
gacagagaaaaagtcctgcagaacatccgccttaactgtgtgaaacacttcaaggagaat
ggcatggatgagccaccaatcttcttgatctctaacatagatctttctgactatgatttc
ccaatcctgatggacaagctgataagtgatctccctgtatacaagcgacacactttcatg
ctctccttacccaatattacagattcaaccattgaaatgaagagacaatgtttgaagcag
aggatttggctcgaagcctttgcagctgacctactgagaatcctcccttcactgactttc
ctcttggacagtgatttggagactctgaagaaatgcctgaagttctatcgcactgtgttt
ggggtggatgatgcagctttgcagagtttagctaaggactggcaaatgccgttggttgag
ctcgaggccatgatgaaatctccgatcgtgttcaaacctacagatgaagaaacaatacat
gaaaggctttcaagatattatcatgattactgttcggctaatggacatttacttactaat
aatcgtgatcttagagaaatatcttacctgaaatattatttccttgacatagtgactgag
gatgctaaaactcttctcaaagagatatgtgtaagaaacaagttggtttctaattag

DBGET integrated database retrieval system