KEGG   Rattus norvegicus (rat): 103694853Help
Entry
103694853         CDS       T01003                                 

Definition
(RefSeq) ribonuclease pancreatic gamma-type
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: RnaseA
Motif
Other DBs
NCBI-GeneID: 103694853
NCBI-ProteinID: XP_008772017
RGD: 9320685
Ensembl: ENSRNOG00000054433
UniProt: Q8VD89
Position
Un
AA seq 152 aa AA seqDB search
MGLEKSLFLFSLLVLVLGWVQPSLGVESRETPAQKFERQHMDEEGPFPSSPTYCNEMMKS
RGMTSGWCKSMNTFVHEPLATVQAICSQGQVTCKNGRNNCHKSSSTLRITDCRLKGSSKY
PNCDYTTTNSQKHIIIACEGNPLVPVHFDDSV
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgggtctggagaagtccctctttctgttttcactgcttgtcctggtgcttggatgggtc
cagccttccctgggtgtagaatctagggaaactccagcccagaagtttgagaggcagcac
atggacgaggagggtcccttcccgagcagccccacctactgtaacgagatgatgaagagc
agggggatgacctcggggtggtgcaagtccatgaacaccttcgtgcatgaacccttggca
acggtccaggccatctgctcccagggacaagtgacctgcaagaatgggaggaacaactgc
cacaagagcagctccaccctgcgcatcactgactgccgcctgaagggcagctccaagtat
cccaattgtgactacacaaccactaacagtcagaagcacatcatcattgcttgtgagggg
aaccccctcgtcccagtccactttgatgattccgtgtag

DBGET integrated database retrieval system