KEGG   Rattus norvegicus (rat): 103694857
Entry
103694857         CDS       T01003                                 

Definition
(RefSeq) hemoglobin subunit beta-2
  KO
K13823  hemoglobin subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05143  African trypanosomiasis
rno05144  Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    103694857
   05143 African trypanosomiasis
    103694857
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    103694857
Membrane trafficking [BR:rno04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    103694857
SSDB
Motif
Pfam: Globin
Other DBs
NCBI-GeneID: 103694857
NCBI-ProteinID: XP_008772023
RGD: 9218369
Ensembl: ENSRNOG00000054582
UniProt: P11517 A0A1K0FUA6
Position
Un
AA seq 147 aa
MVHLTDAEKATVSGLWGKVNADNVGAEALGRLLVVYPWTQRYFSKFGDLSSASAIMGNPQ
VKAHGKKVINAFNDGLKHLDNLKGTFAHLSELHCDKLHVDPENFRLLGNMIVIVLGHHLG
KEFTPCAQAAFQKVVAGVASALAHKYH
NT seq 444 nt   +upstreamnt  +downstreamnt
atggtgcacctaactgatgctgagaaggctactgttagtggcctgtggggaaaggtgaat
gctgataatgttggcgctgaggccctgggcaggctgctggttgtctacccttggacccag
aggtacttttctaaatttggggacctgtcctctgcctctgctatcatgggtaacccccag
gtgaaggcccatggcaagaaggtgataaatgccttcaatgatggcctgaaacacttggac
aacctcaagggcacctttgctcatctgagtgaactccactgtgacaagctgcatgtggat
cctgagaacttcaggctcctgggcaatatgattgtgattgtgttgggccaccacctgggc
aaggaattcaccccgtgtgcacaggctgccttccagaaggtggtggctggagtggccagt
gccctggctcacaagtaccactaa

DBGET integrated database retrieval system