KEGG   Rattus norvegicus (rat): 108348048Help
Entry
108348048         CDS       T01003                                 

Definition
(RefSeq) von Willebrand factor A domain-containing protein 5A
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: VIT VWA_3 VIT_2 VWA_2 VWA
Motif
Other DBs
NCBI-GeneID: 108348048
NCBI-ProteinID: XP_006242901
Ensembl: ENSRNOG00000046414
UniProt: Q75WE7
Position
3q42
AA seq 822 aa AA seqDB search
MEHHWGLITGNKEKVPLKSISVTLSINDFVAAVAATLHYENEEKVPIEAMFVFPMDEDSA
VYSFEALVDGKKIVAELQDKTKAHSKYEEALSQGHQAYLLEEDDYSRDVFSCNVGNLQPG
TKVAVTLRYVQELPLESDGALRYLLPAVLNPRYQLSEQSASSCLNVQKPIVPLEALPYTL
SMVATITSQHGIERVQSNCSLSPIQYLTDDKTSAQVSLTEGHKFDRDVELLIYYREVHSP
SVAVEKGMQDKKRDSLMGAPCAMVSFYPDIPEVNASKVCGEFVFLMDRSGSMQTPMRTEE
NSQLRIEAAKETLLLLLKSLPMGCYFNIYGFGSSYEQFFPESVKYTQETIEEAVERVKRL
DADLGGTEILTPLRNIYKTSSIPGHPLQLFVFTDGEVSDTYSVIREVKLNSKKHRCFSFG
IGQGASTSLIKNIARVSGGTAEFITGKDRMQAKALGSLKLALQCALDDISLSWELPPGLS
VNMLSPEQPTIFRGQRLIIYAQLTGPMPQAESRGAVCLKHTLQGKSLENKVAFSLQPKEN
ANFTIHRLAAKFLIQTKDLGSHEVSKEEKKDVMNISLQSGVLSSFTAFVAINKELNKPVQ
GPLAHRVIPRPMIATSTSMFMRSCSRLTGPFKNSRLKRRLCAADYVPYGHESTVYSSMPS
PAPIENQGVADSSNEKSNSQNEHKAFGENVVLQLIFLQNANGSWKLDENLTKILGTTLED
TKAANPSQHGDPSAWATILAVLWLHANGQDLKCEWELLERKAVAWLHDHAGRGTTPPPFP
SFHLHPREPCLYVLQRTQESLWLSQLCCLRTLSLQLILHFQD
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atggagcatcactggggcctaatcactggcaacaaggagaaagtaccactgaagagcatc
tcagtcaccttgtccatcaatgactttgtggctgctgtggctgcaaccctacattatgag
aatgaggagaaagtcccaatagaggcaatgtttgtgtttcctatggatgaagactctgct
gtctacagctttgaagccttggtggatgggaagaaaatcgtggcagagttgcaggataag
acgaaggcgcacagcaagtatgaggaggcactctcccagggccaccaagcatacttattg
gaagaggatgattattccagggatgtcttttcttgcaatgtggggaacctgcagcctgga
actaaggttgcagttaccttgaggtatgtgcaggaactgccattggaatcagatggggcc
ctgcgctacctgctcccagcagtcttgaatccaagatatcagctttctgaacagtcagcg
agcagttgcttgaatgtacagaagcccattgtccctttggaggccctgccttacacactc
agcatggttgccaccatcacttcccagcatggtattgagagggtccaatccaactgctcc
ttgagccctattcagtaccttacagatgacaagacttctgctcaggtttccttgactgaa
gggcataagtttgaccgggatgtggaactcctgatttactaccgtgaagtgcacagcccc
agtgtagctgtggagaagggaatgcaggacaagaagcgagatagtttgatgggagctcct
tgtgcaatggtgagcttctacccagacatcccagaagtgaacgcctcaaaggtctgtgga
gaatttgtgtttctaatggaccgctcaggaagtatgcaaacccccatgagaacagaggaa
aattctcagctacgcatagaggctgccaaggaaactctgctgttgttgctgaagagtttg
cctatgggttgttattttaacatctatggatttggatcttcctatgaacaattcttcccg
gagagtgtgaagtacactcaggaaacaattgaggaagcagtggaacgagtgaagcgttta
gatgccgatttagggggtactgaaatcttgacacccctccgcaacatttacaagacatcc
tccattcctggacatcccctacagctctttgtcttcacagacggagaagtgagtgacaca
tatagtgtcatcagagaagttaagttaaacagcaagaaacacagatgtttctcatttggt
attggacaaggagcctccaccagcttaatcaaaaacatcgcccgggtatcagggggcact
gcagagtttatcacaggcaaggacaggatgcaggctaaggctcttgggtctctcaagctt
gcgctacagtgtgcattggatgatatctccctgagttgggaattgcctcctggtctgtct
gttaacatgctctctccagagcagcctaccatctttaggggtcagaggttaatcatctat
gcccaactgactgggcctatgcctcaagcggagagcagaggagcagtgtgcctcaagcac
accctccagggcaagagtctggaaaacaaggtggcattttccctacaacccaaggaaaat
gccaattttaccattcatcggttggcggcaaagttcttgattcagaccaaggatttggga
tcccatgaagtctcaaaagaagagaaaaaggatgtgatgaacatcagccttcagtctgga
gttctcagctccttcacagcctttgttgccataaacaaagagcttaacaagccagtgcag
ggccctctggcccacagagtcattcctaggccaatgatagctacatctacatctatgttt
atgaggtcatgcagtcgtctcacaggtccctttaaaaactcacgcctaaaacgtagatta
tgtgcagcagactatgttccatatggacatgaaagcactgtgtattctagcatgccaagt
ccagcacccatagaaaatcagggagtggcagattcttcgaacgagaaaagcaactcgcaa
aatgaacacaaagcatttggggagaatgttgtgttgcagctgatttttctgcaaaatgca
aatggctcctggaagctggatgaaaatctgaccaagatcctgggcactacattggaagac
accaaggctgccaacccttctcagcatggggacccctcagcctgggccacaatcctggct
gtgctctggctccatgccaatggccaggacttaaagtgtgagtgggagcttctggaacgg
aaggctgtggcctggcttcatgatcatgcaggtaggggcacaacccctccgccctttcct
tctttccatttgcatcccagggagccatgcctctatgtgttgcagcgcactcaagagtcc
ctatggctgtcccaactatgctgtctcagaacattgtccctccagctaatccttcatttt
caggattag

DBGET integrated database retrieval system