KEGG   Rattus norvegicus (rat): 108348052
Entry
108348052         CDS       T01003                                 

Definition
(RefSeq) equilibrative nucleoside transporter 2
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    108348052
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    108348052
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC29: Facilitative nucleoside transporter
   108348052
SSDB
Motif
Pfam: Nucleoside_tran
Other DBs
NCBI-GeneID: 108348052
NCBI-ProteinID: XP_017445770
RGD: 11407640
Ensembl: ENSRNOG00000020025
UniProt: O54699
Position
1q43
AA seq 456 aa
MAHGNAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQGRLAGTNSSAETPSTNHTSP
TDTFNFNNWVTLLSQLPLLLFTLLNSFLYQCIPESVRILGSLLAILLLFALTAALVKVDL
SPGLFFSITMASVWFINSFCAVLQGSLFGQLGTMPSTYSTLFLSGQGLAGIFAALAMLTS
LASGVDPQTSALGYFITPCVGILLSIICYLSLPHLKFARYYLTKKPQAPVQELETKAELL
GADEKNGIPVSPQQAGPTLDLDPEKELELGLEEPQKPGKPSVFVVFRKIWLTALCLVLVF
TVTLSVFPAITAMVTTSSNSPGKWSQFFNPICCFLLFNVMDWLGRSLTSYFLWPDEDSQL
LPLLVCLRFLFVPLFMLCHVPQRARLPIIFWQDAYFITFMLLFAISNGYFVSLTMCLAPR
QVLPHEREVAGALMTFFLALGLSCGASLSFLFKALL
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggcgcacggaaacgcccctcgggacagctaccacctggtcgggatcagcttcttcatt
ttgggtctgggcaccctcctcccctggaacttcttcattaccgccatcccgtacttccag
gggcggttggcagggaccaacagcagcgctgagaccccgagcaccaaccacaccagtccc
acagacaccttcaacttcaacaactgggtgacactgctgtcccagctgcctctactgctc
ttcacgctcctcaactccttcttgtatcagtgcatccctgagtcggtgcgtattctgggc
agcctgctggccatactactgctctttgccctgacagcagcgctggtgaaggtggatttg
agccccgggctgttcttttccatcaccatggcatccgtctggttcatcaattccttctgt
gcagtgcttcaaggcagcctctttgggcagttgggtaccatgccttctacctacagcacc
ctcttcctcagtggccagggcctggctgggatcttcgctgcccttgctatgctcacgtcc
ttagccagtggcgtggacccccagacctctgcccttgggtacttcatcacaccctgtgtg
ggcatcctcctctccatcatatgttacctcagtctgccccatctgaagtttgcccgttac
tacctgaccaagaagcctcaggccccagttcaggagctggagaccaaagctgagctcctc
ggagctgatgagaagaatgggattcctgtcagcccccagcaggcaggcccaactctggat
cttgacccagagaaggagctggagctggggctggaggaaccacagaagccaggaaaacct
tcggtctttgtcgtcttccggaagatctggctgacggcgctgtgccttgtgttggtcttc
acagtcaccctgtcggtctttcctgctatcacagccatggtgaccaccagctccaatagc
cccgggaagtggagtcagttcttcaaccctatctgttgcttcctgctcttcaacgtcatg
gattggctgggccggagcctgacttcctacttcctgtggccagatgaggacagccagctg
ctgcccctgctggtgtgcctgcgcttcctgttcgtgcccctcttcatgctgtgtcatgtg
ccccagcgtgcccggctgcccatcatcttctggcaggatgcctacttcatcacattcatg
ctgctcttcgccatttccaacggctacttcgtgtctctcaccatgtgtctggcacccagg
caggtgctgccgcatgagagggaggtggccggagccctcatgaccttcttcctggccctg
ggactctcctgcggagcctctctctccttcctctttaaggctttactctga

DBGET integrated database retrieval system