KEGG   Rattus norvegicus (rat): 108348055
Entry
108348055         CDS       T01003                                 

Definition
(RefSeq) B9 domain-containing protein 1
  KO
K16744  B9 domain-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    108348055
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   TCTN-B9D complex
    108348055
SSDB
Motif
Pfam: B9-C2
Other DBs
NCBI-GeneID: 108348055
NCBI-ProteinID: XP_017453132
RGD: 11475921
Ensembl: ENSRNOG00000002462
UniProt: P0C5J2
Position
10q23
AA seq 204 aa
MAAASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQIASKSQDV
RQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIP
MFVPESTSTLQKFTSWFMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLLFNVVTKDMKK
LGYDTGPVDTQGVLSPSLPQGNPQ
NT seq 615 nt   +upstreamnt  +downstreamnt
atggctgcagcaagtcccagtgtcttcctgctcatggtcaacgggcaggtagagagcgca
cagtttccagagtacgatgacctctactgcaagtactgctttgtgtacggccaggactgg
gccccaacagcgggtctggaagaagggatctcacagatagcatccaagagccaagatgta
cggcaagcactggtgtggaacttccctatcgacgtgacctttaaaagtaccaacccctat
ggctggccacaaattgtactcagcgtgtatggaccggacgtgtttgggaatgacgtggtc
cgaggctatggagcagtgcatgtgcccttctctcctggacggcacaaaaggaccatcccc
atgtttgtgccagagtctacatctacactacagaagttcacaagctggttcatgggacgt
cggccagagtacactgaccccaaggtggtggcccagggtgaaggtcgggaagtgacccgt
gttcgctctcagggatttgttaccctcctcttcaatgtggtgaccaaggacatgaagaag
ctgggctatgatactgggcctgtggacacacaaggagtcctgagtcccagcctgccacag
ggaaacccacaataa

DBGET integrated database retrieval system