KEGG   Rattus norvegicus (rat): 108348061Help
Entry
108348061         CDS       T01003                                 

Definition
(RefSeq) glutathione S-transferase alpha-3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108348061
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108348061
   00982 Drug metabolism - cytochrome P450
    108348061
   00983 Drug metabolism - other enzymes
    108348061
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108348061
   05204 Chemical carcinogenesis
    108348061
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    108348061
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    108348061
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108348061
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    108348061
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108348061
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   108348061
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3
Motif
Other DBs
NCBI-GeneID: 108348061
NCBI-ProteinID: XP_017452251
RGD: 11504935
Ensembl: ENSRNOG00000013484
UniProt: P04904 B6DYP8
Position
9q13
AA seq 221 aa AA seqDB search
MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEEQFLKTRDDLARLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYAEGVADLDEIVLHYPYIPPGEKEAS
LAKIKDKARNRYFPAFEKVLKSHGQDYLVGNRLSRADVYLVQVLYHVEELDPSALANFPL
LKALRTRVSNLPTVKKFLQPGSQRKPLEDEKCVESAVKIFS
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgccggggaagccagtccttcactacttcgatggcagggggagaatggagcccatccgg
tggctcctggctgcagctggagtagagtttgaagaacaatttctgaaaactcgggatgac
ctggccaggctaaggaatgatgggagtttgatgttccagcaagtgcccatggtggagatt
gatgggatgaagctggtgcagaccagagccattctcaactacattgccaccaaatacaac
ctctatgggaaggacatgaaggagagagccctcatcgacatgtatgcagaaggagtggcg
gatctggatgaaatagttctccattacccttacattccccctggggagaaagaggcaagt
cttgccaaaatcaaggacaaagcaaggaaccgttactttcctgcctttgaaaaggtgttg
aagagccatggacaagattatctcgttggcaataggctgagcagggctgatgtttaccta
gttcaagttctctaccatgtggaagagctggaccccagcgctttggccaacttccctctg
ctgaaggccctgagaaccagagtcagcaacctccccacagtgaagaagtttcttcagcct
ggcagccagaggaagccattagaggatgagaaatgtgtagaatctgcagttaagatcttc
agttaa

DBGET integrated database retrieval system