KEGG   Rattus norvegicus (rat): 108348072Help
Entry
108348072         CDS       T01003                                 

Definition
(RefSeq) class II histocompatibility antigen, M alpha chain
  KO
K06752  MHC class II antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04514  Cell adhesion molecules (CAMs)
rno04612  Antigen processing and presentation
rno04640  Hematopoietic cell lineage
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04672  Intestinal immune network for IgA production
rno04940  Type I diabetes mellitus
rno05140  Leishmaniasis
rno05145  Toxoplasmosis
rno05150  Staphylococcus aureus infection
rno05152  Tuberculosis
rno05164  Influenza A
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05321  Inflammatory bowel disease (IBD)
rno05322  Systemic lupus erythematosus
rno05323  Rheumatoid arthritis
rno05330  Allograft rejection
rno05332  Graft-versus-host disease
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    108348072
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108348072
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    108348072
   04612 Antigen processing and presentation
    108348072
   04658 Th1 and Th2 cell differentiation
    108348072
   04659 Th17 cell differentiation
    108348072
   04672 Intestinal immune network for IgA production
    108348072
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    108348072
   05322 Systemic lupus erythematosus
    108348072
   05323 Rheumatoid arthritis
    108348072
   05320 Autoimmune thyroid disease
    108348072
   05321 Inflammatory bowel disease (IBD)
    108348072
   05330 Allograft rejection
    108348072
   05332 Graft-versus-host disease
    108348072
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108348072
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    108348072
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    108348072
   05152 Tuberculosis
    108348072
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    108348072
   05164 Influenza A
    108348072
   05168 Herpes simplex virus 1 infection
    108348072
   05169 Epstein-Barr virus infection
    108348072
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108348072
   05140 Leishmaniasis
    108348072
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    108348072
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108348072
  Exosomal proteins of epithelial cells
   108348072
  Exosomal proteins of breast milk
   108348072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_II_alpha C1-set SKG6
Motif
Other DBs
NCBI-GeneID: 108348072
NCBI-ProteinID: XP_017443523
RGD: 11505944
Ensembl: ENSRNOG00000047864
Vega: OTTRNOG00000001828
UniProt: Q95574
Position
20p12
AA seq 260 aa AA seqDB search
MEHEQKSGGLLRLLRLLWLLPHSWAVLEASPQAWWDESQNHTFRHTLFCQDGFPNIGLSE
TYDEDALFSFDFSQNTRVPRLPEFAEWAQEQGDASAIAFDKGFCDMLMQNVSPRLEGQIP
VSRGLPSAEVFTLKPLEFGKPNTLVCFISNLFPPTLTVTWQHHFVPVEGASPTSVSAIDG
LTFQAFSYLNFTPEPFDLYSCTVTHEIDRYTAIAYWVPQNALPSDLLENVLCGVAFGLGV
LGLVVGIVFFIRSQRPCSGD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggagcatgagcagaagtcaggagggctgctgaggctgctgcggcttctgtggctgctg
cctcactcctgggcggtgcttgaagcttctccccaggcgtggtgggatgagtcgcagaac
cacacattccgtcacactctgttctgccaggatgggtttcccaacatagggctctccgag
acctacgacgaggacgcactcttctccttcgacttctcccagaacaccagagtgccccgg
ctgcctgagtttgctgagtgggctcaggaacagggagatgcctctgccattgcgtttgac
aaaggcttctgcgacatgttgatgcagaatgtgagcccgcggcttgaaggtcaaatccca
gtgtccagaggtttgccttcggctgaggtgttcaccctgaagcccctggagtttggcaag
cccaacacgctggtctgtttcatcagcaacctctttccaccgactttgacggtgacctgg
cagcatcatttcgtccccgtggagggagccagccccacatccgtttcagccatcgatggg
ctcaccttccaggccttctcttatttaaacttcacaccggaacccttcgacctttactcc
tgcactgtgacgcacgagattgaccgctacacggcgattgcctattgggtaccccagaac
gccctgccttcagatctcctggagaatgtactgtgcggtgtggccttcggcctcggtgtg
ctgggcctcgtcgtgggcattgtcttcttcatccgctcccagagaccttgctcaggggac
tga

DBGET integrated database retrieval system