KEGG   Rattus norvegicus (rat): 108348086Help
Entry
108348086         CDS       T01003                                 

Definition
(RefSeq) 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4
  KO
K00070  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno01100  Metabolic pathways
rno04913  Ovarian steroidogenesis
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04934  Cushing syndrome
Module
rno_M00107  Steroid hormone biosynthesis, cholesterol => prognenolone => progesterone
rno_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    108348086
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    108348086
   04925 Aldosterone synthesis and secretion
    108348086
   04927 Cortisol synthesis and secretion
    108348086
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108348086
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     108348086
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     108348086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_4 GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind NmrA Ldh_1_N KR Ufm1 Sacchrp_dh_NADP DapB_N
Motif
Other DBs
NCBI-GeneID: 108348086
NCBI-ProteinID: XP_017446814
RGD: 11496463
Ensembl: ENSRNOG00000019441
UniProt: Q62878
Position
2q34
AA seq 373 aa AA seqDB search
MPGWSCLVTGAGGFLGQRIVQLLVQEKDLKEVRVLDKVFRPETREEFFNLGTSIKVTVLE
GDILDTQCLRRACQGISVVIHTAALIDVTGVNPRQTILDVNLKGTQNLLEACVQASVPAF
IYCSTVDVAGPNSYKKIILNGHEEEHHESTWSNPYPYSKKMAEKAVLAANGSILKNGGTL
HTCALRPMYIYGERSPFLSVMILAALKSKGILNVTGKFSIANPVYVGNVAWAHILAARGL
RDPKKSQNVQGQFYYISDDTPHQSYDDLNYTLSKEWGLHLDSSWSLPLPLLYWLAFLLEI
VSFFLHPVYNYRPSFNRHLVTLSNSKFTFSYKKAQRDLGYKPLVSWEEAKQKTSEWIGTL
VEQHRETLDTKSQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggtggagctgcctggtgactggagcaggagggtttttgggccagaggatcgtc
cagttgttggtgcaggagaaagatctgaaggaggtcagggtcctggacaaggtcttcaga
ccagaaaccagagaagaattcttcaacctagggacaagcatcaaggtgacagtgttggaa
ggagacattcttgacacccagtgcctgaggagagcgtgccagggcatctctgttgtcatc
cacactgccgccctcattgatgtcacaggtgtcaatcccaggcagaccatcctagatgtc
aatctgaaaggtacccagaatctgttggaggcctgtgtccaagctagtgtgccagccttc
atctactgcagcacagttgacgttgcagggcccaactcctacaagaagatcatcctgaat
ggccatgaggaagagcatcatgaaagcacatggtcaaatccatacccatacagcaaaaag
atggccgagaaggcagtgctggcagccaatgggagcatcctgaaaaatggtggcacattg
catacttgtgccttaaggcccatgtacatttatggggagagaagtccattcctttctgtc
atgatacttgcggccctcaaaagtaagggtattctgaatgttactggcaaattctccata
gccaatccagtgtatgtaggcaatgtggcctgggcacatattctggctgccaggggcctt
cgagaccccaagaagtcacaaaatgtccaaggacagttctactacatctcagatgacacc
cctcaccaaagctatgatgatttaaattataccctgagcaaggaatggggcctccacctt
gattccagttggagccttcctctgcccctgctctactggcttgccttcctgctggaaatt
gtgagcttctttctgcatccagtgtacaactataggccatcctttaaccgccacttggtc
acactgtcaaatagcaagttcactttctcctacaagaaagctcagagagatctgggctat
aagccacttgtcagctgggaggaagccaagcagaaaacctcggagtggatcgggacacta
gtggagcagcacagggagacattggacacaaagtctcagtaa

DBGET integrated database retrieval system