KEGG   Rattus norvegicus (rat): 108348091
Entry
108348091         CDS       T01003                                 

Definition
(RefSeq) erythroid transcription factor
  KO
K09182  GATA-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    108348091
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    108348091
SSDB
Motif
Pfam: GATA TF_Zn_Ribbon Zn-ribbon_8 ArfGap
Other DBs
NCBI-GeneID: 108348091
NCBI-ProteinID: XP_017457744
RGD: 11399827
Ensembl: ENSRNOG00000025534
UniProt: P43429
Position
Xq12
AA seq 413 aa
MDFPGLGALGTSEPLPQFVDSALVSSTSDSAGFFSSGPESLDTASSSTSPNAATAAATAL
AYYREAEAYRHSPVFQVYPLLNSMEGIPGSSPYASWAYSKTALYPASTVCPSHEDAPSQT
LEDPDGKNNNTFLETLKTERLSPDLLTLGTALPTSLPVTSSAYGGADFPSPFFSPTGSPL
SSAAYSSPKFHGSLPLAPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRP
LIRPKKRMIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD
GIQTRNRKASGKGKKKRGSSLAGAGAAEGPAGGFMVVAGGSSSGNCGEVAPGLTLGTAGT
AHLYQGLGPVVLSGPVSHLMSFPGPLLGSPTASFPTGPVPTTTSTSVVSPLSS
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggattttcctggtctaggggccctgggaacctcagaacccttgccccagtttgtggat
tctgccctggtgtcctcgacatcagactcagcgggtttcttttcctctgggcctgagagt
ttggatacagcatcttcctccacttctccaaatgcagccacggcagcagccacggcactg
gcctactacagagaagctgaggcctacagacactccccagtctttcaggtgtacccgctg
ctcaacagtatggagggaatcccagggagctcaccttatgctagctgggcctatagcaag
acggcgctctaccctgcctcaactgtatgtcccagtcatgaggatgccccttcccagacc
ctggaagacccagatgggaagaacaacaatacattcttggaaaccttgaagacggagcgg
ctgagtccagacctcctgaccctggggactgcactgcctacatcactccctgtcaccagc
agtgcttatgggggagctgactttcccagtcctttcttctctcccactgggagccctctc
agctcagcagcctattcttcccccaagtttcatggaagcctaccattggctccttgtgag
gccagagagtgtgtgaactgtggagcaacggctactccactgtggcggagggacaggaca
ggtcactacctgtgcaatgcttgtggcttgtatcacaagatgaatggtcagaaccggcct
ctcatccggcccaagaagcgaatgattgtcagcaagcgagcaggcacccaatgcactaac
tgtcaaacaacaaccacgaccctctggcggaggaatgccagtggagacccggtgtgcaat
gcctgcggcctctactacaagctgcaccaggtgaaccgcccactgaccatgaggaaagat
ggaatccagacgaggaaccgcaaggcatctggaaaagggaaaaagaagcggggctcaagt
ctggccggagcaggagcggctgaaggaccagctggtggattcatggtggtagctggtggc
agcagtagtgggaattgcggagaggtggccccaggcttgacactgggcactgcaggtact
gcccatctctaccagggcctgggacctgtggtgctgtcagggcctgtcagccatcttatg
tctttccctggacctctgctgggatcgcctacggcctccttccccacaggtcctgtgcct
accaccaccagcactagcgtagtgtctccactcagttcttga

DBGET integrated database retrieval system