KEGG   Rattus norvegicus (rat): 108348092Help
Entry
108348092         CDS       T01003                                 

Gene name
NEWGENE_1582771, Katnbl1
Definition
(RefSeq) katanin regulatory subunit B1 like 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Katanin_con80
Motif
Other DBs
NCBI-GeneID: 108348092
NCBI-ProteinID: XP_017447678
RGD: 11483591
Ensembl: ENSRNOG00000005814
UniProt: B1WBZ9
Position
3q35
AA seq 299 aa AA seqDB search
MAFDTHHVKKRNFSNSIDLPRKRISNFTSKNMKEVKISPKQLAAYISRTVGQAVKSPDKL
RKVLYHRKLVRHSFPNPCYKTKQSPRSGGCDMANKENELACAGHLPENLHHDSRTFVINT
SDSGSSQTENPSSKYSGFFSEVSQDHETMAQVLFSRNLRLNVALTFWRKRSVSELVAYLV
RIEDLGVVVDCLPVLTNSLQEEKQCISLGCCVDLFPLVKSLLQSRFEEYVIVGLNWLQAV
IKRWWSELSSKSEIISDGNIKILKQQLNGLWEQENHLTLVPGYTGNIAKDVDAYLLQLH
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgatactcaccatgttaaaaaacggaacttctctaatagtattgatcttcct
agaaagaggatctctaattttaccagtaagaacatgaaggaggttaagatatctccaaaa
cagttggctgcgtacataagtagaacagttggacaagcagtgaaaagcccagataagctg
cgcaaggtactctaccacagaaagttagttcgtcattcattcccaaatccttgttacaaa
actaagcagtcccctagaagtgggggctgtgacatggcaaataaagaaaatgaactggct
tgtgcaggccatctacctgaaaatttacaccatgacagtcggacatttgtcattaacacc
agtgattctgggtcttcacagacagaaaacccatcatcaaaatatagtggtttcttttct
gaggtttctcaggaccatgagacaatggcccaagttctattcagcaggaatttgagattg
aatgtagctttgactttctggagaaagagaagtgttagtgaacttgtagcttatttagtg
aggatagaagaccttggagttgtggtagattgccttcctgttctaaccaatagtttacag
gaagaaaagcaatgtatctctcttggctgctgtgtagacttatttcctctagtaaagtct
ttacttcaaagcagatttgaagaatatgtaattgttggcttaaactggcttcaagcagta
ataaaaaggtggtggtcagaactctcatctaaatcagaaattataagtgatggaaatatt
aagattttaaagcaacagttgaatggattatgggaacaggaaaaccatcttactttggtt
ccaggatatactggtaatatagctaaggacgtagatgcttatttattacagctgcattga

DBGET integrated database retrieval system