KEGG   Rattus norvegicus (rat): 108348098Help
Entry
108348098         CDS       T01003                                 

Definition
(RefSeq) breast cancer metastasis-suppressor 1 homolog
  KO
K19196  breast cancer metastasis-suppressor 1 and related proteins
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    108348098
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     108348098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sds3 Dynactin_p62 PIP5K Vfa1
Motif
Other DBs
NCBI-GeneID: 108348098
NCBI-ProteinID: XP_017445773
RGD: 11501278
Ensembl: ENSRNOG00000047683
UniProt: Q5M7T3
Position
1q43
AA seq 246 aa AA seqDB search
MPIQPSGKETEEMEAEGDSAAEMNGEADESEEERSGSQTESEEESSEMDDEDYERRRSEC
VSEMLDLEKQFSELKEKLFRERLSQLRLRLEEVGAERAPEYTEPLGGLQQSLKIRIQVAG
IYKGFCLDVIRNKYECELQGAKQHLESEKLLLYDTLLGELQERIQRLEEDRQSLDISSEW
WDDKLHSRGSSKTWDSVPPSKRKKAPLVSGPYIVYMLQEIDILEDWTAIKKARAAVSPQK
RKADGP
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcccatccagccttcagggaaagaaacagaagagatggaggcagaaggcgattcagca
gctgagatgaacggggaggcagatgagagtgaggaggaacggagcggcagccagactgag
tcagaggaggagagctcagagatggatgacgaggactatgagcggcgccgcagtgagtgt
gtcagtgagatgctggacctggaaaagcagttctcggagctgaaggagaagttgttcagg
gaacggctgagccagctgcgattacgactggaggaagtgggggccgagagagccccagaa
tatacagagcctcttggagggctacagcagagcctaaagattcgtattcaggtggcaggg
atctacaagggcttctgtctggatgtgatcaggaataagtatgaatgtgaactacaggga
gccaaacagcacctcgagagtgagaagctgctgctgtatgacacactgcttggggagctg
caggagcggatccagaggctggaggaggacagacagagcctggacatcagctctgagtgg
tgggacgacaaactacatagcaggggcagttcgaagacctgggactcagtgccacccagc
aagaggaagaaggcaccactcgtttctggcccatacattgtgtacatgctgcaggagatc
gacatcctggaagactggacggccatcaaaaaggccagggcagcagtgtcccctcagaag
agaaaagcagatggaccctga

DBGET integrated database retrieval system