KEGG   Rattus norvegicus (rat): 108348131Help
Entry
108348131         CDS       T01003                                 

Gene name
NEWGENE_620180, Slc40a1
Definition
(RefSeq) solute carrier family 40 member 1
  KO
K14685  solute carrier family 40 (iron-regulated transporter), member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04216  Ferroptosis
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    108348131 (NEWGENE_620180)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    108348131 (NEWGENE_620180)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    108348131 (NEWGENE_620180)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC40: Basolateral iron transporter
   108348131 (NEWGENE_620180)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FPN1 DUF347 DUF5373
Motif
Other DBs
NCBI-GeneID: 108348131
NCBI-ProteinID: XP_017452293
RGD: 11441106
Ensembl: ENSRNOG00000003872
UniProt: G3V6H7
Position
9q22
AA seq 570 aa AA seqDB search
MTKSRDQTHQEGCCGSLANYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLLL
TAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVILCGIILMMVFLHKNEL
LNMYHGWVLTVCYILIITIANIANLASTATAITIQRDWIVVVAGENRSRLADMNATIRRI
DQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYFLLWKVYQKTPALAVKAALK
VEESELKQLTSPKDTEPKPLEGTHLMGEKDSNIRELECEQEPTCASQIAEPFRTFRDGWV
SYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSVLMGASAITGIMGTVAF
TWLRRKCGLVRTGLFSGLAQLSCLILCVISVFMPGSPLDLSVSPFEDIRSRFIHEEAVSS
TTKIPETEMLMSNVSNVVNTVHEMSTKSVPIISVSLLFAGVIAARIGLWSFDLTVTQLLQ
ENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVLISVSFVAMGHLMYFRF
AQKTLGNQIFVCAPDEKEVTDESQPNTSVV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagtcaagagatcagacccatcaggaaggatgctgtggatctttagcaaactac
ctgacctcagcaaaattcctcctctaccttggccactctctctccacttggggggatcgg
atgtggcactttgcagtgtctgtgtttctggtggaactctacggaaacagcctcctcttg
acagctgtctacgggttggtggtggcaggctctgttctggtcctgggagccatcattggt
gactgggtggataagaatgccagacttaaagtggcccagacgtccctggtggttcagaat
gtatcagtcattctctgcgggatcatcctgatgatggttttcttacacaagaatgagctt
ctgaacatgtatcatggatgggtccttactgtctgctacatcctgatcatcaccattgca
aacattgcgaatttggccagtactgccactgcaattacaatccaaagggactggattgtt
gtcgtagcaggagaaaacaggagcagattagcagacatgaatgctaccattagaaggatt
gaccagctaaccaacatcctggcccccatggctgttggccagattatgacattcggttcc
ccagtcattggctgtggtttcatttctggttggaatttggtgtccatgtgtgtggagtac
ttcttgctctggaaggtttaccagaagacccctgctctggctgtaaaagctgctctcaag
gtagaggagtcagaactgaagcagctgacctcacctaaagatactgagccaaaacctttg
gagggaactcacctaatgggtgagaaagactctaacatccgtgaacttgaatgtgaacaa
gaacccacctgtgcctcccagatcgcagaacccttccgcacttttcgagatggatgggtc
tcctactataaccagcccgtatttttggctggcatgggcctggctttcctctatatgaca
gtcctgggcttcgactgtatcaccacaggatatgcttacactcagggactgagtggttcc
atcctcagtgttttgatgggagcatcagcaataactggaataatgggaactgtggccttc
acttggctacgtcgaaaatgtggccttgttcggactggtctgttctcaggactggctcag
ctttcttgtttgatcttgtgtgtgatctccgtgttcatgcctggaagccccttggacctg
tctgtttctccatttgaagatatccgttctaggtttatacatgaggaggcagtgtcctca
actaccaaaatacctgaaacagaaatgcttatgtctaatgtgtctaatgttgtcaatacc
gtccatgagatgagtactaaatccgtccccataatctccgtcagcctgctgtttgcagga
gtcattgctgctagaatcggtctttggtcctttgatttgactgtgacacagttgctgcaa
gaaaatgtaattgaatcagaaagaggcattatcaatggtgtgcagaactccatgaactac
cttctcgaccttctgcatttcatcatggtcatcttggccccaaatcctgaagcttttggc
ttgctagtattgatttcagtctcctttgtggcaatgggacatcttatgtatttccgtttt
gcccagaagactctgggcaaccagatttttgtttgtgctcctgatgaaaaggaagttaca
gatgaaagtcagcctaatacatctgttgtgtaa

DBGET integrated database retrieval system