KEGG   Rattus norvegicus (rat): 108348144Help
Entry
108348144         CDS       T01003                                 

Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
  KO
K03945  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05016  Huntington disease
Module
rno_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    108348144
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    108348144
  09159 Environmental adaptation
   04714 Thermogenesis
    108348144
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108348144
   05012 Parkinson disease
    108348144
   05016 Huntington disease
    108348144
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    108348144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MWFE
Motif
Other DBs
NCBI-GeneID: 108348144
NCBI-ProteinID: XP_017443807
RGD: 11430296
UniProt: G3V9S6
Position
Xq35
AA seq 70 aa AA seqDB search
MWFEILPGLAIMGVCLVIPGVSTAYIHKFTNGGKEKRVARVHYQWYLMERDRRISGVNRY
YVSKGLENID
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcgagattctccctggcctcgccattatgggggtgtgcctggtcatccccggg
gtgtccactgcgtacatccacaagttcaccaacgggggcaaggaaaagagagttgctcga
gttcattaccaatggtatttgatggaacgcgatagacgcatctctggtgtcaatcgctac
tatgtgtccaagggcctggagaacattgactaa

DBGET integrated database retrieval system